Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NSS96_RS14940 Genome accession   NZ_CP151980
Coordinates   2880455..2880595 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus sp. FSL W7-1336     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2875455..2885595
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NSS96_RS14915 (NSS96_14915) - 2875789..2876178 (-) 390 WP_024423321.1 hotdog fold thioesterase -
  NSS96_RS14920 (NSS96_14920) comA 2876202..2876843 (-) 642 WP_101676435.1 response regulator transcription factor Regulator
  NSS96_RS14925 (NSS96_14925) comP 2876924..2879215 (-) 2292 WP_101676436.1 ATP-binding protein Regulator
  NSS96_RS14930 (NSS96_14930) comX 2879229..2879402 (-) 174 WP_046313343.1 competence pheromone ComX -
  NSS96_RS14935 (NSS96_14935) - 2879380..2880303 (-) 924 WP_065215228.1 polyprenyl synthetase family protein -
  NSS96_RS14940 (NSS96_14940) degQ 2880455..2880595 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  NSS96_RS14945 (NSS96_14945) - 2881101..2881457 (+) 357 WP_101676437.1 inner spore coat protein -
  NSS96_RS14950 (NSS96_14950) - 2881493..2882719 (-) 1227 WP_024423326.1 HDOD domain-containing protein -
  NSS96_RS14955 (NSS96_14955) - 2882857..2884329 (-) 1473 WP_046313339.1 nicotinate phosphoribosyltransferase -
  NSS96_RS14960 (NSS96_14960) - 2884347..2884898 (-) 552 WP_305933760.1 isochorismatase family cysteine hydrolase -
  NSS96_RS14965 (NSS96_14965) - 2884959..2885366 (-) 408 WP_034282575.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=983205 NSS96_RS14940 WP_003213123.1 2880455..2880595(-) (degQ) [Bacillus sp. FSL W7-1336]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=983205 NSS96_RS14940 WP_003213123.1 2880455..2880595(-) (degQ) [Bacillus sp. FSL W7-1336]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATCAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment