Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NSS78_RS14780 Genome accession   NZ_CP151974
Coordinates   2890904..2891044 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus sp. FSL W8-0920     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2885904..2896044
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NSS78_RS14755 (NSS78_14755) - 2886169..2886558 (-) 390 WP_106066313.1 hotdog fold thioesterase -
  NSS78_RS14760 (NSS78_14760) comA 2886582..2887223 (-) 642 WP_003213500.1 response regulator transcription factor Regulator
  NSS78_RS14765 (NSS78_14765) comP 2887304..2889616 (-) 2313 WP_340866486.1 ATP-binding protein Regulator
  NSS78_RS14770 (NSS78_14770) comX 2889671..2889841 (-) 171 WP_212045489.1 competence pheromone ComX -
  NSS78_RS14775 (NSS78_14775) - 2889838..2890752 (-) 915 WP_212045490.1 polyprenyl synthetase family protein -
  NSS78_RS14780 (NSS78_14780) degQ 2890904..2891044 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  NSS78_RS14785 (NSS78_14785) - 2891550..2891903 (+) 354 WP_339205997.1 inner spore coat protein -
  NSS78_RS14790 (NSS78_14790) - 2891934..2893160 (-) 1227 WP_212045764.1 HDOD domain-containing protein -
  NSS78_RS14795 (NSS78_14795) - 2893301..2894770 (-) 1470 WP_003212630.1 nicotinate phosphoribosyltransferase -
  NSS78_RS14800 (NSS78_14800) - 2894788..2895339 (-) 552 WP_003213138.1 isochorismatase family cysteine hydrolase -
  NSS78_RS14805 (NSS78_14805) - 2895400..2895807 (-) 408 WP_212045493.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=982864 NSS78_RS14780 WP_003213123.1 2890904..2891044(-) (degQ) [Bacillus sp. FSL W8-0920]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=982864 NSS78_RS14780 WP_003213123.1 2890904..2891044(-) (degQ) [Bacillus sp. FSL W8-0920]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696

Multiple sequence alignment