Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   NYE49_RS12330 Genome accession   NZ_CP151962
Coordinates   2419809..2419982 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus sp. FSL L8-0358     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2414809..2424982
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NYE49_RS12315 (NYE49_12315) gcvT 2415608..2416696 (-) 1089 WP_015384081.1 glycine cleavage system aminomethyltransferase GcvT -
  NYE49_RS12320 (NYE49_12320) - 2417138..2418811 (+) 1674 WP_047182869.1 SNF2-related protein -
  NYE49_RS12325 (NYE49_12325) - 2418832..2419626 (+) 795 WP_003230200.1 YqhG family protein -
  NYE49_RS12330 (NYE49_12330) sinI 2419809..2419982 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  NYE49_RS12335 (NYE49_12335) sinR 2420016..2420351 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NYE49_RS12340 (NYE49_12340) tasA 2420444..2421229 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  NYE49_RS12345 (NYE49_12345) - 2421293..2421865 (-) 573 WP_080030740.1 signal peptidase I -
  NYE49_RS12350 (NYE49_12350) tapA 2421849..2422610 (-) 762 WP_047182870.1 amyloid fiber anchoring/assembly protein TapA -
  NYE49_RS12355 (NYE49_12355) - 2422880..2423206 (+) 327 WP_047183570.1 YqzG/YhdC family protein -
  NYE49_RS12360 (NYE49_12360) - 2423248..2423427 (-) 180 WP_003230176.1 YqzE family protein -
  NYE49_RS12365 (NYE49_12365) comGG 2423499..2423873 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  NYE49_RS12370 (NYE49_12370) comGF 2423874..2424257 (-) 384 WP_015384087.1 ComG operon protein ComGF Machinery gene
  NYE49_RS12375 (NYE49_12375) comGE 2424283..2424630 (-) 348 WP_047182872.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=982336 NYE49_RS12330 WP_003230187.1 2419809..2419982(+) (sinI) [Bacillus sp. FSL L8-0358]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=982336 NYE49_RS12330 WP_003230187.1 2419809..2419982(+) (sinI) [Bacillus sp. FSL L8-0358]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment