Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | NYE38_RS12110 | Genome accession | NZ_CP151944 |
| Coordinates | 2477755..2477928 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus sp. EU63 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2472755..2482928
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYE38_RS12095 (NYE38_12095) | gcvT | 2473568..2474668 (-) | 1101 | WP_017418134.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| NYE38_RS12100 (NYE38_12100) | - | 2475092..2476762 (+) | 1671 | WP_017418135.1 | SNF2-related protein | - |
| NYE38_RS12105 (NYE38_12105) | - | 2476784..2477578 (+) | 795 | WP_014305407.1 | YqhG family protein | - |
| NYE38_RS12110 (NYE38_12110) | sinI | 2477755..2477928 (+) | 174 | WP_014418369.1 | anti-repressor SinI family protein | Regulator |
| NYE38_RS12115 (NYE38_12115) | sinR | 2477962..2478297 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| NYE38_RS12120 (NYE38_12120) | - | 2478345..2479130 (-) | 786 | WP_017418136.1 | TasA family protein | - |
| NYE38_RS12125 (NYE38_12125) | - | 2479195..2479779 (-) | 585 | WP_012117977.1 | signal peptidase I | - |
| NYE38_RS12130 (NYE38_12130) | tapA | 2479751..2480422 (-) | 672 | WP_025649852.1 | amyloid fiber anchoring/assembly protein TapA | - |
| NYE38_RS12135 (NYE38_12135) | - | 2480681..2481010 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| NYE38_RS12140 (NYE38_12140) | - | 2481051..2481230 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| NYE38_RS12145 (NYE38_12145) | comGG | 2481287..2481664 (-) | 378 | WP_017418138.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| NYE38_RS12150 (NYE38_12150) | comGF | 2481665..2482060 (-) | 396 | WP_025649850.1 | competence type IV pilus minor pilin ComGF | - |
| NYE38_RS12155 (NYE38_12155) | comGE | 2482074..2482388 (-) | 315 | WP_017418140.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| NYE38_RS12160 (NYE38_12160) | comGD | 2482372..2482809 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=981602 NYE38_RS12110 WP_014418369.1 2477755..2477928(+) (sinI) [Bacillus sp. EU63]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=981602 NYE38_RS12110 WP_014418369.1 2477755..2477928(+) (sinI) [Bacillus sp. EU63]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |