Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   NYE38_RS12155 Genome accession   NZ_CP151944
Coordinates   2482074..2482388 (-) Length   104 a.a.
NCBI ID   WP_017418140.1    Uniprot ID   A0AAP3YC32
Organism   Bacillus sp. EU63     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2477074..2487388
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NYE38_RS12110 (NYE38_12110) sinI 2477755..2477928 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  NYE38_RS12115 (NYE38_12115) sinR 2477962..2478297 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  NYE38_RS12120 (NYE38_12120) - 2478345..2479130 (-) 786 WP_017418136.1 TasA family protein -
  NYE38_RS12125 (NYE38_12125) - 2479195..2479779 (-) 585 WP_012117977.1 signal peptidase I -
  NYE38_RS12130 (NYE38_12130) tapA 2479751..2480422 (-) 672 WP_025649852.1 amyloid fiber anchoring/assembly protein TapA -
  NYE38_RS12135 (NYE38_12135) - 2480681..2481010 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  NYE38_RS12140 (NYE38_12140) - 2481051..2481230 (-) 180 WP_003153093.1 YqzE family protein -
  NYE38_RS12145 (NYE38_12145) comGG 2481287..2481664 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  NYE38_RS12150 (NYE38_12150) comGF 2481665..2482060 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  NYE38_RS12155 (NYE38_12155) comGE 2482074..2482388 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  NYE38_RS12160 (NYE38_12160) comGD 2482372..2482809 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  NYE38_RS12165 (NYE38_12165) comGC 2482799..2483107 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  NYE38_RS12170 (NYE38_12170) comGB 2483112..2484149 (-) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  NYE38_RS12175 (NYE38_12175) comGA 2484136..2485206 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  NYE38_RS12180 (NYE38_12180) - 2485399..2486349 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11785.77 Da        Isoelectric Point: 5.8181

>NTDB_id=981605 NYE38_RS12155 WP_017418140.1 2482074..2482388(-) (comGE) [Bacillus sp. EU63]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADPGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=981605 NYE38_RS12155 WP_017418140.1 2482074..2482388(-) (comGE) [Bacillus sp. EU63]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACGCTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGCCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCCCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481


Multiple sequence alignment