Detailed information    

insolico Bioinformatically predicted

Overview


Name   cipB   Type   Regulator
Locus tag   ABXG87_RS08405 Genome accession   NZ_AP031488
Coordinates   1792174..1792332 (-) Length   52 a.a.
NCBI ID   WP_073688425.1    Uniprot ID   -
Organism   Streptococcus salivarius strain NBRC 13956     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context


Location: 1787174..1797332
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABXG87_RS08385 (Ssa13956_15950) - 1787623..1789890 (+) 2268 WP_353551470.1 Xaa-Pro dipeptidyl-peptidase -
  ABXG87_RS08390 (Ssa13956_15960) - 1790464..1790880 (-) 417 WP_353551472.1 hypothetical protein -
  ABXG87_RS08395 (Ssa13956_15970) - 1791106..1791402 (-) 297 WP_353551474.1 bacteriocin immunity protein -
  ABXG87_RS08400 - 1791770..1792162 (-) 393 WP_003094909.1 hypothetical protein -
  ABXG87_RS08405 (Ssa13956_15980) cipB 1792174..1792332 (-) 159 WP_073688425.1 Blp family class II bacteriocin Regulator
  ABXG87_RS08410 (Ssa13956_15990) comE/blpR 1792572..1793309 (+) 738 WP_353551475.1 response regulator transcription factor Regulator
  ABXG87_RS08415 - 1793303..1794679 (+) 1377 WP_353551476.1 GHKL domain-containing protein -
  ABXG87_RS08420 (Ssa13956_16010) - 1794713..1794862 (-) 150 Protein_1606 ISL3 family transposase -
  ABXG87_RS08425 (Ssa13956_16020) - 1795527..1795943 (-) 417 WP_004183358.1 hypothetical protein -
  ABXG87_RS08430 - 1796463..1796864 (-) 402 WP_004183361.1 hypothetical protein -

Sequence


Protein


Download         Length: 52 a.a.        Molecular weight: 5298.02 Da        Isoelectric Point: 3.9868

>NTDB_id=98124 ABXG87_RS08405 WP_073688425.1 1792174..1792332(-) (cipB) [Streptococcus salivarius strain NBRC 13956]
MATQTIENFNTLDLETLASVEGGRVNWERWGMCGASVAVGAAIGGGVALLGC

Nucleotide


Download         Length: 159 bp        

>NTDB_id=98124 ABXG87_RS08405 WP_073688425.1 1792174..1792332(-) (cipB) [Streptococcus salivarius strain NBRC 13956]
ATGGCAACTCAAACAATTGAAAACTTTAACACCCTCGACCTTGAAACACTTGCTAGTGTTGAAGGAGGACGAGTCAATTG
GGAACGATGGGGAATGTGTGGGGCCTCTGTCGCCGTAGGTGCAGCTATTGGAGGTGGAGTAGCCTTACTTGGCTGTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

44.643

100

0.481


Multiple sequence alignment