Detailed information NTG0980980

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: AAFV99_RS10850
• Genome accession: NZ_CP151815
• Coordinates: 2125888..2126199 (+)
• Length: 103 a.a.
• NCBI ID: WP_000472256.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain PS006-42
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2120888..2131199

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
AAFV99_RS10825 (AAFV99_10825)	-	2120943..2121272 (+)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
AAFV99_RS10830 (AAFV99_10830)	-	2121269..2121892 (+)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
AAFV99_RS10835 (AAFV99_10835)	-	2122187..2123833 (+)	1647	WP_000277718.1	IS1182 family transposase	-
AAFV99_RS10840 (AAFV99_10840)	comGA	2123858..2124832 (+)	975	WP_000697220.1	competence type IV pilus ATPase ComGA	Machinery gene
AAFV99_RS10845 (AAFV99_10845)	comGB	2124804..2125874 (+)	1071	WP_000776422.1	competence type IV pilus assembly protein ComGB	Machinery gene
AAFV99_RS10850 (AAFV99_10850)	comGC	2125888..2126199 (+)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
AAFV99_RS10855 (AAFV99_10855)	comGD	2126177..2126623 (+)	447	WP_001788899.1	competence type IV pilus minor pilin ComGD	Machinery gene
AAFV99_RS10860 (AAFV99_10860)	comGE	2126610..2126909 (+)	300	WP_000844413.1	hypothetical protein	Machinery gene
AAFV99_RS10865 (AAFV99_10865)	comGF	2126827..2127324 (+)	498	WP_029642894.1	competence type IV pilus minor pilin ComGF	Machinery gene
AAFV99_RS10870 (AAFV99_10870)	-	2127421..2127567 (+)	147	WP_001789879.1	hypothetical protein	-
AAFV99_RS10875 (AAFV99_10875)	-	2127557..2128081 (+)	525	WP_001015123.1	shikimate kinase	-
AAFV99_RS10880 (AAFV99_10880)	gcvT	2128240..2129331 (+)	1092	WP_000093348.1	glycine cleavage system aminomethyltransferase GcvT	-
AAFV99_RS10885 (AAFV99_10885)	gcvPA	2129351..2130697 (+)	1347	WP_000019689.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11315.36 Da
• Isoelectric Point: 8.5268

>NTDB_id=980980 AAFV99_RS10850 WP_000472256.1 2125888..2126199(+) (comGC) [Staphylococcus aureus strain PS006-42]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=980980 AAFV99_RS10850 WP_000472256.1 2125888..2126199(+) (comGC) [Staphylococcus aureus strain PS006-42]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	100	100	1
comGC	Staphylococcus aureus N315	100	100	1
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369