Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   WA044_RS11850 Genome accession   NZ_CP151554
Coordinates   2446173..2446487 (-) Length   104 a.a.
NCBI ID   WP_015388003.1    Uniprot ID   -
Organism   Bacillus velezensis strain E69     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2441173..2451487
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WA044_RS11805 (WA044_11805) sinI 2441856..2442029 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  WA044_RS11810 (WA044_11810) sinR 2442063..2442398 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  WA044_RS11815 (WA044_11815) - 2442446..2443231 (-) 786 WP_015388008.1 TasA family protein -
  WA044_RS11820 (WA044_11820) - 2443295..2443879 (-) 585 WP_012117977.1 signal peptidase I -
  WA044_RS11825 (WA044_11825) tapA 2443851..2444522 (-) 672 WP_058906184.1 amyloid fiber anchoring/assembly protein TapA -
  WA044_RS11830 (WA044_11830) - 2444781..2445110 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  WA044_RS11835 (WA044_11835) - 2445150..2445329 (-) 180 WP_003153093.1 YqzE family protein -
  WA044_RS11840 (WA044_11840) comGG 2445386..2445763 (-) 378 WP_015388005.1 competence type IV pilus minor pilin ComGG Machinery gene
  WA044_RS11845 (WA044_11845) comGF 2445764..2446159 (-) 396 WP_015388004.1 competence type IV pilus minor pilin ComGF -
  WA044_RS11850 (WA044_11850) comGE 2446173..2446487 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  WA044_RS11855 (WA044_11855) comGD 2446471..2446908 (-) 438 WP_058906185.1 competence type IV pilus minor pilin ComGD Machinery gene
  WA044_RS11860 (WA044_11860) comGC 2446898..2447206 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  WA044_RS11865 (WA044_11865) comGB 2447211..2448248 (-) 1038 WP_058906186.1 competence type IV pilus assembly protein ComGB Machinery gene
  WA044_RS11870 (WA044_11870) comGA 2448235..2449305 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  WA044_RS11875 (WA044_11875) - 2449497..2450447 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11844.85 Da        Isoelectric Point: 6.9470

>NTDB_id=979123 WA044_RS11850 WP_015388003.1 2446173..2446487(-) (comGE) [Bacillus velezensis strain E69]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=979123 WA044_RS11850 WP_015388003.1 2446173..2446487(-) (comGE) [Bacillus velezensis strain E69]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGACGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGCGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481


Multiple sequence alignment