Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | WA044_RS11805 | Genome accession | NZ_CP151554 |
| Coordinates | 2441856..2442029 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain E69 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2436856..2447029
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WA044_RS11790 (WA044_11790) | gcvT | 2437674..2438774 (-) | 1101 | WP_058906182.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| WA044_RS11795 (WA044_11795) | - | 2439197..2440867 (+) | 1671 | WP_058906183.1 | SNF2-related protein | - |
| WA044_RS11800 (WA044_11800) | - | 2440885..2441679 (+) | 795 | WP_014305407.1 | YqhG family protein | - |
| WA044_RS11805 (WA044_11805) | sinI | 2441856..2442029 (+) | 174 | WP_003153105.1 | anti-repressor SinI family protein | Regulator |
| WA044_RS11810 (WA044_11810) | sinR | 2442063..2442398 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| WA044_RS11815 (WA044_11815) | - | 2442446..2443231 (-) | 786 | WP_015388008.1 | TasA family protein | - |
| WA044_RS11820 (WA044_11820) | - | 2443295..2443879 (-) | 585 | WP_012117977.1 | signal peptidase I | - |
| WA044_RS11825 (WA044_11825) | tapA | 2443851..2444522 (-) | 672 | WP_058906184.1 | amyloid fiber anchoring/assembly protein TapA | - |
| WA044_RS11830 (WA044_11830) | - | 2444781..2445110 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| WA044_RS11835 (WA044_11835) | - | 2445150..2445329 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| WA044_RS11840 (WA044_11840) | comGG | 2445386..2445763 (-) | 378 | WP_015388005.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| WA044_RS11845 (WA044_11845) | comGF | 2445764..2446159 (-) | 396 | WP_015388004.1 | competence type IV pilus minor pilin ComGF | - |
| WA044_RS11850 (WA044_11850) | comGE | 2446173..2446487 (-) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| WA044_RS11855 (WA044_11855) | comGD | 2446471..2446908 (-) | 438 | WP_058906185.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=979120 WA044_RS11805 WP_003153105.1 2441856..2442029(+) (sinI) [Bacillus velezensis strain E69]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=979120 WA044_RS11805 WP_003153105.1 2441856..2442029(+) (sinI) [Bacillus velezensis strain E69]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |