Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | AAEO79_RS02205 | Genome accession | NZ_CP151540 |
| Coordinates | 454509..454952 (+) | Length | 147 a.a. |
| NCBI ID | WP_379946437.1 | Uniprot ID | - |
| Organism | Enterococcus devriesei strain Ed-CK-24 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 441700..481740 | 454509..454952 | within | 0 |
Gene organization within MGE regions
Location: 441700..481740
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AAEO79_RS02090 (AAEO79_02090) | - | 441700..442836 (-) | 1137 | WP_379946419.1 | tyrosine-type recombinase/integrase | - |
| AAEO79_RS02095 (AAEO79_02095) | - | 442955..443530 (-) | 576 | WP_379946420.1 | Ltp family lipoprotein | - |
| AAEO79_RS02100 (AAEO79_02100) | - | 443624..444280 (-) | 657 | WP_379946421.1 | LexA family protein | - |
| AAEO79_RS02105 (AAEO79_02105) | - | 444439..444684 (+) | 246 | WP_379946422.1 | helix-turn-helix transcriptional regulator | - |
| AAEO79_RS02110 (AAEO79_02110) | - | 444686..445441 (+) | 756 | WP_379946423.1 | BRO family protein | - |
| AAEO79_RS02115 (AAEO79_02115) | - | 445487..445732 (+) | 246 | WP_379946424.1 | hypothetical protein | - |
| AAEO79_RS02120 (AAEO79_02120) | - | 445745..445924 (+) | 180 | WP_379946425.1 | hypothetical protein | - |
| AAEO79_RS02125 (AAEO79_02125) | istB | 445927..446691 (-) | 765 | WP_379945620.1 | IS21-like element helper ATPase IstB | - |
| AAEO79_RS02130 (AAEO79_02130) | istA | 446705..447931 (-) | 1227 | WP_379945619.1 | IS21 family transposase | - |
| AAEO79_RS02135 (AAEO79_02135) | - | 448051..448194 (+) | 144 | WP_379946426.1 | hypothetical protein | - |
| AAEO79_RS02140 (AAEO79_02140) | - | 448169..448393 (-) | 225 | WP_379946427.1 | hypothetical protein | - |
| AAEO79_RS02145 | - | 448606..448743 (-) | 138 | WP_379946428.1 | hypothetical protein | - |
| AAEO79_RS02150 (AAEO79_02145) | - | 448824..449285 (+) | 462 | WP_379946429.1 | hypothetical protein | - |
| AAEO79_RS02155 (AAEO79_02150) | - | 449298..449450 (+) | 153 | WP_251868212.1 | hypothetical protein | - |
| AAEO79_RS02160 (AAEO79_02155) | - | 449569..450096 (-) | 528 | WP_379946430.1 | hypothetical protein | - |
| AAEO79_RS02165 (AAEO79_02160) | - | 450154..450300 (+) | 147 | WP_379946431.1 | hypothetical protein | - |
| AAEO79_RS02170 (AAEO79_02165) | - | 450337..450675 (+) | 339 | WP_379946433.1 | hypothetical protein | - |
| AAEO79_RS02175 (AAEO79_02170) | - | 450759..451298 (+) | 540 | WP_379946434.1 | host-nuclease inhibitor Gam family protein | - |
| AAEO79_RS02180 (AAEO79_02175) | - | 451300..452298 (+) | 999 | WP_379946435.1 | AAA family ATPase | - |
| AAEO79_RS02185 (AAEO79_02180) | - | 452303..453055 (+) | 753 | WP_090409164.1 | putative HNHc nuclease | - |
| AAEO79_RS02190 (AAEO79_02185) | - | 453058..453222 (+) | 165 | WP_177184106.1 | hypothetical protein | - |
| AAEO79_RS02195 (AAEO79_02190) | - | 453236..454099 (+) | 864 | WP_369906925.1 | replisome organizer | - |
| AAEO79_RS02200 (AAEO79_02195) | - | 454096..454512 (+) | 417 | WP_379946436.1 | RusA family crossover junction endodeoxyribonuclease | - |
| AAEO79_RS02205 (AAEO79_02200) | ssb | 454509..454952 (+) | 444 | WP_379946437.1 | single-stranded DNA-binding protein | Machinery gene |
| AAEO79_RS02210 (AAEO79_02205) | - | 454964..455320 (+) | 357 | WP_379946438.1 | hypothetical protein | - |
| AAEO79_RS02215 (AAEO79_02210) | - | 455321..455563 (+) | 243 | WP_379946439.1 | hypothetical protein | - |
| AAEO79_RS02220 (AAEO79_02215) | - | 455599..455856 (+) | 258 | WP_379946440.1 | hypothetical protein | - |
| AAEO79_RS02225 (AAEO79_02220) | - | 456155..456430 (+) | 276 | WP_379946441.1 | hypothetical protein | - |
| AAEO79_RS02230 (AAEO79_02225) | - | 456412..456621 (+) | 210 | WP_379946442.1 | hypothetical protein | - |
| AAEO79_RS02235 (AAEO79_02230) | - | 456618..456785 (+) | 168 | WP_379946443.1 | hypothetical protein | - |
| AAEO79_RS02240 (AAEO79_02235) | - | 456782..456952 (+) | 171 | WP_379946444.1 | hypothetical protein | - |
| AAEO79_RS02245 (AAEO79_02240) | - | 456988..457284 (+) | 297 | WP_379946445.1 | DUF1140 family protein | - |
| AAEO79_RS02250 (AAEO79_02245) | - | 457332..457667 (+) | 336 | WP_379946446.1 | hypothetical protein | - |
| AAEO79_RS02255 (AAEO79_02250) | - | 457678..458085 (+) | 408 | WP_379946448.1 | hypothetical protein | - |
| AAEO79_RS02260 (AAEO79_02255) | - | 458082..458258 (+) | 177 | WP_379946449.1 | hypothetical protein | - |
| AAEO79_RS02265 (AAEO79_02260) | - | 458293..458658 (+) | 366 | WP_379946450.1 | hypothetical protein | - |
| AAEO79_RS02270 (AAEO79_02265) | - | 458645..458818 (+) | 174 | WP_379946451.1 | hypothetical protein | - |
| AAEO79_RS02275 (AAEO79_02270) | - | 459069..459485 (+) | 417 | WP_084133326.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| AAEO79_RS02280 (AAEO79_02275) | - | 459883..460368 (+) | 486 | WP_379946452.1 | terminase | - |
| AAEO79_RS02285 (AAEO79_02280) | - | 460355..461653 (+) | 1299 | WP_379946453.1 | PBSX family phage terminase large subunit | - |
| AAEO79_RS02290 (AAEO79_02285) | - | 461668..463167 (+) | 1500 | WP_379946454.1 | phage portal protein | - |
| AAEO79_RS02295 (AAEO79_02290) | - | 463167..463427 (+) | 261 | WP_379946455.1 | hypothetical protein | - |
| AAEO79_RS02300 (AAEO79_02295) | - | 463432..464589 (+) | 1158 | WP_379946456.1 | phage minor capsid protein | - |
| AAEO79_RS02305 (AAEO79_02300) | - | 464605..464775 (+) | 171 | WP_379946457.1 | hypothetical protein | - |
| AAEO79_RS02310 (AAEO79_02305) | - | 464872..465438 (+) | 567 | WP_379946458.1 | phage scaffolding protein | - |
| AAEO79_RS02315 (AAEO79_02310) | - | 465441..466301 (+) | 861 | WP_379946459.1 | capsid protein | - |
| AAEO79_RS02320 (AAEO79_02315) | - | 466319..466564 (+) | 246 | WP_379946902.1 | Ig domain-containing protein | - |
| AAEO79_RS02325 (AAEO79_02320) | - | 466604..467008 (+) | 405 | WP_379946461.1 | hypothetical protein | - |
| AAEO79_RS02330 (AAEO79_02325) | - | 467002..467343 (+) | 342 | WP_379946462.1 | putative minor capsid protein | - |
| AAEO79_RS02335 (AAEO79_02330) | - | 467343..467669 (+) | 327 | WP_379946463.1 | minor capsid protein | - |
| AAEO79_RS02340 (AAEO79_02335) | - | 467669..468067 (+) | 399 | WP_379946903.1 | minor capsid protein | - |
| AAEO79_RS02345 (AAEO79_02340) | - | 468067..468549 (+) | 483 | WP_379946464.1 | phage tail tube protein | - |
| AAEO79_RS02350 | - | 468567..468821 (+) | 255 | WP_379946904.1 | fibronectin type III domain-containing protein | - |
| AAEO79_RS02355 (AAEO79_02345) | - | 468832..469218 (+) | 387 | WP_379946466.1 | DUF6673 family protein | - |
| AAEO79_RS02360 (AAEO79_02350) | - | 469224..469790 (+) | 567 | WP_379946468.1 | Gp15 family bacteriophage protein | - |
| AAEO79_RS02365 (AAEO79_02355) | - | 469783..472719 (+) | 2937 | WP_379946469.1 | tape measure protein | - |
| AAEO79_RS02370 (AAEO79_02360) | - | 472710..473471 (+) | 762 | WP_379946470.1 | phage tail protein | - |
| AAEO79_RS02375 (AAEO79_02365) | - | 473468..475735 (+) | 2268 | WP_379946471.1 | phage tail spike protein | - |
| AAEO79_RS02380 (AAEO79_02370) | - | 475725..478259 (+) | 2535 | WP_379946472.1 | glycerophosphodiester phosphodiesterase family protein | - |
| AAEO79_RS02385 (AAEO79_02375) | - | 478283..478672 (+) | 390 | WP_379946473.1 | hypothetical protein | - |
| AAEO79_RS02390 (AAEO79_02380) | - | 478662..478874 (+) | 213 | WP_379946474.1 | phage holin | - |
| AAEO79_RS02395 (AAEO79_02385) | - | 478888..479943 (+) | 1056 | WP_379946475.1 | N-acetylmuramoyl-L-alanine amidase | - |
| AAEO79_RS02405 (AAEO79_02395) | licT | 480892..481740 (+) | 849 | WP_313631346.1 | BglG family transcription antiterminator LicT | - |
Sequence
Protein
Download Length: 147 a.a. Molecular weight: 16097.72 Da Isoelectric Point: 5.8910
>NTDB_id=979014 AAEO79_RS02205 WP_379946437.1 454509..454952(+) (ssb) [Enterococcus devriesei strain Ed-CK-24]
MINNVVLQGKLGKDIDLKYTQSGKAVASVSIASTRDFKDANGNRETDWINLVFWGKTAETVANYFKKGDEILVIGRLQVR
NYEDQQGNKKYVTEVVVSNFSFPGGKSKESPQSNSSGNSFSNNHNSKPNADSLNGSSIDIGDDDLPF
MINNVVLQGKLGKDIDLKYTQSGKAVASVSIASTRDFKDANGNRETDWINLVFWGKTAETVANYFKKGDEILVIGRLQVR
NYEDQQGNKKYVTEVVVSNFSFPGGKSKESPQSNSSGNSFSNNHNSKPNADSLNGSSIDIGDDDLPF
Nucleotide
Download Length: 444 bp
>NTDB_id=979014 AAEO79_RS02205 WP_379946437.1 454509..454952(+) (ssb) [Enterococcus devriesei strain Ed-CK-24]
ATGATAAACAATGTAGTTTTGCAAGGAAAATTAGGTAAAGACATCGATTTAAAATATACACAATCAGGCAAAGCAGTTGC
TTCTGTAAGCATTGCATCTACGAGAGACTTTAAAGATGCTAACGGAAATAGAGAGACCGATTGGATCAATCTTGTGTTTT
GGGGTAAGACAGCTGAAACAGTTGCTAATTACTTTAAAAAAGGCGACGAGATTTTAGTAATTGGAAGACTTCAAGTTAGA
AATTATGAAGATCAACAAGGAAATAAGAAATATGTTACCGAGGTGGTTGTTAGTAATTTCAGCTTCCCCGGAGGAAAGAG
TAAAGAAAGCCCACAAAGCAATTCTTCAGGCAATTCATTTAGCAATAACCATAATAGTAAACCAAATGCTGATTCACTAA
ATGGTTCGTCAATCGACATCGGTGACGATGATCTGCCGTTTTAG
ATGATAAACAATGTAGTTTTGCAAGGAAAATTAGGTAAAGACATCGATTTAAAATATACACAATCAGGCAAAGCAGTTGC
TTCTGTAAGCATTGCATCTACGAGAGACTTTAAAGATGCTAACGGAAATAGAGAGACCGATTGGATCAATCTTGTGTTTT
GGGGTAAGACAGCTGAAACAGTTGCTAATTACTTTAAAAAAGGCGACGAGATTTTAGTAATTGGAAGACTTCAAGTTAGA
AATTATGAAGATCAACAAGGAAATAAGAAATATGTTACCGAGGTGGTTGTTAGTAATTTCAGCTTCCCCGGAGGAAAGAG
TAAAGAAAGCCCACAAAGCAATTCTTCAGGCAATTCATTTAGCAATAACCATAATAGTAAACCAAATGCTGATTCACTAA
ATGGTTCGTCAATCGACATCGGTGACGATGATCTGCCGTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
47.674 |
100 |
0.558 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
41.279 |
100 |
0.483 |
| ssb | Vibrio cholerae strain A1552 |
31.214 |
100 |
0.367 |