Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | R8522_RS02580 | Genome accession | NZ_AP026916 |
| Coordinates | 501713..501862 (+) | Length | 49 a.a. |
| NCBI ID | WP_001809846.1 | Uniprot ID | Q00MV6 |
| Organism | Streptococcus pneumoniae strain PZ900700006 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 496713..506862
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| R8522_RS02555 (PC0006_05190) | comA/nlmT | 497745..499421 (-) | 1677 | WP_196302068.1 | peptide cleavage/export ABC transporter | Regulator |
| R8522_RS02560 (PC0006_05200) | comA/nlmT | 499315..499902 (-) | 588 | WP_000205166.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| R8522_RS02565 (PC0006_05210) | blpI | 500183..500380 (+) | 198 | WP_001093259.1 | bacteriocin-like peptide BlpI | - |
| R8522_RS02570 (PC0006_05230) | blpJ | 500847..501116 (+) | 270 | WP_050122544.1 | bacteriocin-like peptide BlpJ | - |
| R8522_RS02575 (PC0006_05240) | - | 501185..501469 (+) | 285 | WP_050122547.1 | Blp family class II bacteriocin | - |
| R8522_RS02580 (PC0006_05250) | cipB | 501713..501862 (+) | 150 | WP_001809846.1 | bacteriocin-like peptide BlpO | Regulator |
| R8522_RS02585 | - | 501966..502085 (+) | 120 | WP_001833623.1 | PncF family bacteriocin immunity protein | - |
| R8522_RS02590 (PC0006_05270) | - | 502567..502925 (+) | 359 | Protein_511 | immunity protein | - |
| R8522_RS02595 | - | 503086..504055 (+) | 970 | Protein_512 | thioredoxin domain-containing protein | - |
| R8522_RS02600 (PC0006_05300) | - | 504302..504535 (+) | 234 | WP_050122549.1 | bacteriocin class II family protein | - |
| R8522_RS02605 (PC0006_05310) | - | 504567..505256 (+) | 690 | WP_000760541.1 | CPBP family intramembrane glutamic endopeptidase | - |
| R8522_RS02610 (PC0006_05320) | blpZ | 505298..505546 (+) | 249 | WP_000276499.1 | immunity protein BlpZ | - |
| R8522_RS02615 | - | 505576..506187 (+) | 612 | WP_050122551.1 | CPBP family intramembrane glutamic endopeptidase | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5149.92 Da Isoelectric Point: 4.0439
>NTDB_id=97629 R8522_RS02580 WP_001809846.1 501713..501862(+) (cipB) [Streptococcus pneumoniae strain PZ900700006]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=97629 R8522_RS02580 WP_001809846.1 501713..501862(+) (cipB) [Streptococcus pneumoniae strain PZ900700006]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
53.061 |
100 |
0.531 |