Detailed information    

insolico Bioinformatically predicted

Overview


Name   pilV   Type   Machinery gene
Locus tag   KDR_RS02785 Genome accession   NZ_CP150840
Coordinates   552092..552568 (-) Length   158 a.a.
NCBI ID   WP_034349477.1    Uniprot ID   -
Organism   Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539 strain ATCC 13939     
Function   assembly of type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Genomic island 535128..552049 552092..552568 flank 43


Gene organization within MGE regions


Location: 535128..552568
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KDR_RS02715 - 535128..537230 (-) 2103 WP_010887179.1 protein kinase domain-containing protein -
  KDR_RS02720 - 537199..539793 (-) 2595 WP_027479533.1 hypothetical protein -
  KDR_RS02725 - 539797..540402 (-) 606 WP_010887181.1 OmpA family protein -
  KDR_RS02730 - 540427..541497 (-) 1071 WP_227085990.1 hypothetical protein -
  KDR_RS02735 - 541666..544866 (-) 3201 WP_227085991.1 tubulin-like doman-containing protein -
  KDR_RS02740 - 544878..545207 (-) 330 WP_010887184.1 hypothetical protein -
  KDR_RS02745 - 545207..546526 (-) 1320 WP_162177565.1 hypothetical protein -
  KDR_RS02750 - 546737..547531 (-) 795 WP_034349478.1 DUF72 domain-containing protein -
  KDR_RS02755 - 547556..548233 (-) 678 WP_010887187.1 glycerophosphodiester phosphodiesterase -
  KDR_RS02760 - 548338..549021 (+) 684 WP_010887188.1 SDR family oxidoreductase -
  KDR_RS02765 - 549098..549865 (+) 768 WP_010887189.1 sulfite exporter TauE/SafE family protein -
  KDR_RS02770 - 549862..550137 (+) 276 WP_027479532.1 hypothetical protein -
  KDR_RS02775 - 550121..550498 (-) 378 WP_010887191.1 type IV pilin protein -
  KDR_RS02780 - 550865..552049 (+) 1185 WP_162177563.1 HTTM domain-containing protein -
  KDR_RS02785 pilV 552092..552568 (-) 477 WP_034349477.1 prepilin-type N-terminal cleavage/methylation domain-containing protein Machinery gene

Sequence


Protein


Download         Length: 158 a.a.        Molecular weight: 15369.17 Da        Isoelectric Point: 7.5899

>NTDB_id=972861 KDR_RS02785 WP_034349477.1 552092..552568(-) (pilV) [Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539 strain ATCC 13939]
MKNTTQGFTLIELLIVIAIIGILAAVLIPNLLGARAKANDSATQSYIRNCYTAVEVARGADGRLPAAGNCDSTANLGTNA
VATPGAITAAGAYSLDGTGSKFAVTATSVTNKTFCFDGAKMGEGTGATGACTFSTSTGTGTGTGTGTGTGTGTGTGSN

Nucleotide


Download         Length: 477 bp        

>NTDB_id=972861 KDR_RS02785 WP_034349477.1 552092..552568(-) (pilV) [Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539 strain ATCC 13939]
ATGAAGAACACCACCCAAGGCTTCACCCTGATCGAACTGCTCATCGTCATCGCCATCATCGGCATCCTGGCCGCCGTGTT
GATCCCCAACCTGCTGGGCGCCCGCGCCAAGGCCAACGACAGCGCCACCCAGAGCTACATCCGCAACTGCTACACCGCCG
TGGAAGTGGCCCGTGGTGCTGACGGCCGCCTGCCTGCTGCTGGCAACTGCGACAGCACGGCCAACCTGGGTACCAACGCT
GTGGCTACCCCTGGTGCAATCACTGCGGCAGGCGCTTACAGCCTGGATGGTACTGGTAGCAAGTTTGCCGTTACTGCCAC
CAGCGTGACCAACAAGACCTTCTGCTTCGACGGCGCGAAGATGGGCGAAGGCACTGGCGCTACTGGTGCCTGCACCTTCA
GCACCAGCACCGGCACCGGCACTGGTACCGGCACTGGTACCGGCACTGGCACCGGCACTGGTACCGGCAGCAACTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilV Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539

100

100

1


Multiple sequence alignment