Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   WMC51_RS11700 Genome accession   NZ_CP150636
Coordinates   2439241..2439618 (-) Length   125 a.a.
NCBI ID   WP_032874019.1    Uniprot ID   -
Organism   Bacillus velezensis strain ML21     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2434241..2444618
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WMC51_RS11660 (WMC51_11660) - 2434738..2435532 (+) 795 WP_007612541.1 YqhG family protein -
  WMC51_RS11665 (WMC51_11665) sinI 2435709..2435882 (+) 174 WP_032874029.1 anti-repressor SinI family protein Regulator
  WMC51_RS11670 (WMC51_11670) sinR 2435916..2436251 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  WMC51_RS11675 (WMC51_11675) - 2436299..2437084 (-) 786 WP_032874027.1 TasA family protein -
  WMC51_RS11680 (WMC51_11680) - 2437149..2437733 (-) 585 WP_032874025.1 signal peptidase I -
  WMC51_RS11685 (WMC51_11685) tapA 2437705..2438376 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  WMC51_RS11690 (WMC51_11690) - 2438635..2438964 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  WMC51_RS11695 (WMC51_11695) - 2439005..2439184 (-) 180 WP_022552966.1 YqzE family protein -
  WMC51_RS11700 (WMC51_11700) comGG 2439241..2439618 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  WMC51_RS11705 (WMC51_11705) comGF 2439619..2440119 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  WMC51_RS11710 (WMC51_11710) comGE 2440028..2440342 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  WMC51_RS11715 (WMC51_11715) comGD 2440326..2440763 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  WMC51_RS11720 (WMC51_11720) comGC 2440753..2441061 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  WMC51_RS11725 (WMC51_11725) comGB 2441066..2442103 (-) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  WMC51_RS11730 (WMC51_11730) comGA 2442090..2443160 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  WMC51_RS11735 (WMC51_11735) - 2443357..2444307 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14077.01 Da        Isoelectric Point: 10.2236

>NTDB_id=970804 WMC51_RS11700 WP_032874019.1 2439241..2439618(-) (comGG) [Bacillus velezensis strain ML21]
MSKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMAQGKKARTGTQRFPYGTVS
FHISGSDRRETVQVTIQTETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=970804 WMC51_RS11700 WP_032874019.1 2439241..2439618(-) (comGG) [Bacillus velezensis strain ML21]
ATGTCCAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCAGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGGCACAGGGAAAAAAGGCCCGAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCTCCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGACGGAAACCACGACAGGTACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

49.194

99.2

0.488

Multiple sequence alignment