Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   WHC13_RS17260 Genome accession   NZ_CP150487
Coordinates   3256693..3256833 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain JNF2     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3251693..3261833
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WHC13_RS17235 (WHC13_17235) yuxO 3252007..3252387 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  WHC13_RS17240 (WHC13_17240) comA 3252406..3253050 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  WHC13_RS17245 (WHC13_17245) comP 3253131..3255439 (-) 2309 Protein_3333 two-component system sensor histidine kinase ComP -
  WHC13_RS17250 (WHC13_17250) comX 3255454..3255621 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  WHC13_RS17255 (WHC13_17255) comQ 3255609..3256508 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  WHC13_RS17260 (WHC13_17260) degQ 3256693..3256833 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  WHC13_RS17265 (WHC13_17265) - 3257055..3257180 (+) 126 WP_003228793.1 hypothetical protein -
  WHC13_RS17270 (WHC13_17270) - 3257294..3257662 (+) 369 WP_003243784.1 hypothetical protein -
  WHC13_RS17275 (WHC13_17275) pdeH 3257638..3258867 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  WHC13_RS17280 (WHC13_17280) pncB 3259004..3260476 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  WHC13_RS17285 (WHC13_17285) pncA 3260492..3261043 (-) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  WHC13_RS17290 (WHC13_17290) yueI 3261140..3261538 (-) 399 WP_003242987.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=970615 WHC13_RS17260 WP_003220708.1 3256693..3256833(-) (degQ) [Bacillus subtilis strain JNF2]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=970615 WHC13_RS17260 WP_003220708.1 3256693..3256833(-) (degQ) [Bacillus subtilis strain JNF2]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment