Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   WHC13_RS13370 Genome accession   NZ_CP150487
Coordinates   2552045..2552218 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain JNF2     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2547045..2557218
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WHC13_RS13355 (WHC13_13355) gcvT 2547844..2548932 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  WHC13_RS13360 (WHC13_13360) yqhH 2549374..2551047 (+) 1674 WP_004398544.1 SNF2-related protein -
  WHC13_RS13365 (WHC13_13365) yqhG 2551068..2551862 (+) 795 WP_003230200.1 YqhG family protein -
  WHC13_RS13370 (WHC13_13370) sinI 2552045..2552218 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  WHC13_RS13375 (WHC13_13375) sinR 2552252..2552587 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  WHC13_RS13380 (WHC13_13380) tasA 2552680..2553465 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  WHC13_RS13385 (WHC13_13385) sipW 2553529..2554101 (-) 573 WP_003246088.1 signal peptidase I -
  WHC13_RS13390 (WHC13_13390) tapA 2554085..2554846 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  WHC13_RS13395 (WHC13_13395) yqzG 2555118..2555444 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  WHC13_RS13400 (WHC13_13400) spoIIT 2555486..2555665 (-) 180 WP_003230176.1 YqzE family protein -
  WHC13_RS13405 (WHC13_13405) comGG 2555736..2556110 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  WHC13_RS13410 (WHC13_13410) comGF 2556111..2556494 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  WHC13_RS13415 (WHC13_13415) comGE 2556520..2556867 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=970590 WHC13_RS13370 WP_003230187.1 2552045..2552218(+) (sinI) [Bacillus subtilis strain JNF2]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=970590 WHC13_RS13370 WP_003230187.1 2552045..2552218(+) (sinI) [Bacillus subtilis strain JNF2]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment