Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   MHB62_RS12175 Genome accession   NZ_CP150278
Coordinates   2384751..2385125 (-) Length   124 a.a.
NCBI ID   WP_029726722.1    Uniprot ID   -
Organism   Bacillus sp. FSL K6-0255     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2379751..2390125
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MHB62_RS12135 (MHB62_12135) - 2380082..2380876 (+) 795 WP_015714249.1 YqhG family protein -
  MHB62_RS12140 (MHB62_12140) sinI 2381059..2381232 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  MHB62_RS12145 (MHB62_12145) sinR 2381266..2381601 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  MHB62_RS12150 (MHB62_12150) tasA 2381694..2382479 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  MHB62_RS12155 (MHB62_12155) sipW 2382543..2383115 (-) 573 WP_072692741.1 signal peptidase I SipW -
  MHB62_RS12160 (MHB62_12160) tapA 2383099..2383860 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  MHB62_RS12165 (MHB62_12165) - 2384132..2384458 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  MHB62_RS12170 (MHB62_12170) - 2384500..2384679 (-) 180 WP_029726723.1 YqzE family protein -
  MHB62_RS12175 (MHB62_12175) comGG 2384751..2385125 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  MHB62_RS12180 (MHB62_12180) comGF 2385126..2385509 (-) 384 WP_032722118.1 ComG operon protein ComGF Machinery gene
  MHB62_RS12185 (MHB62_12185) comGE 2385535..2385882 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  MHB62_RS12190 (MHB62_12190) comGD 2385866..2386297 (-) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  MHB62_RS12195 (MHB62_12195) comGC 2386287..2386583 (-) 297 WP_029726719.1 comG operon protein ComGC Machinery gene
  MHB62_RS12200 (MHB62_12200) comGB 2386597..2387634 (-) 1038 WP_029317912.1 comG operon protein ComGB Machinery gene
  MHB62_RS12205 (MHB62_12205) comGA 2387621..2388691 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  MHB62_RS12210 (MHB62_12210) - 2388904..2389101 (-) 198 WP_014480259.1 CBS domain-containing protein -
  MHB62_RS12215 (MHB62_12215) corA 2389103..2390056 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14443.63 Da        Isoelectric Point: 7.8383

>NTDB_id=969264 MHB62_RS12175 WP_029726722.1 2384751..2385125(-) (comGG) [Bacillus sp. FSL K6-0255]
MYCTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSVRHVLEERKGQEGTEQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=969264 MHB62_RS12175 WP_029726722.1 2384751..2385125(-) (comGG) [Bacillus sp. FSL K6-0255]
ATGTATTGTACAAGAGGGTTTATTTACCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAGAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGGTCCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGGAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

95.161

100

0.952

Multiple sequence alignment