Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   MHB62_RS12140 Genome accession   NZ_CP150278
Coordinates   2381059..2381232 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus sp. FSL K6-0255     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2376059..2386232
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MHB62_RS12125 (MHB62_12125) gcvT 2376858..2377946 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  MHB62_RS12130 (MHB62_12130) - 2378388..2380061 (+) 1674 WP_029726726.1 DEAD/DEAH box helicase -
  MHB62_RS12135 (MHB62_12135) - 2380082..2380876 (+) 795 WP_015714249.1 YqhG family protein -
  MHB62_RS12140 (MHB62_12140) sinI 2381059..2381232 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  MHB62_RS12145 (MHB62_12145) sinR 2381266..2381601 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  MHB62_RS12150 (MHB62_12150) tasA 2381694..2382479 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  MHB62_RS12155 (MHB62_12155) sipW 2382543..2383115 (-) 573 WP_072692741.1 signal peptidase I SipW -
  MHB62_RS12160 (MHB62_12160) tapA 2383099..2383860 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  MHB62_RS12165 (MHB62_12165) - 2384132..2384458 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  MHB62_RS12170 (MHB62_12170) - 2384500..2384679 (-) 180 WP_029726723.1 YqzE family protein -
  MHB62_RS12175 (MHB62_12175) comGG 2384751..2385125 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  MHB62_RS12180 (MHB62_12180) comGF 2385126..2385509 (-) 384 WP_032722118.1 ComG operon protein ComGF Machinery gene
  MHB62_RS12185 (MHB62_12185) comGE 2385535..2385882 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=969262 MHB62_RS12140 WP_003230187.1 2381059..2381232(+) (sinI) [Bacillus sp. FSL K6-0255]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=969262 MHB62_RS12140 WP_003230187.1 2381059..2381232(+) (sinI) [Bacillus sp. FSL K6-0255]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment