Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | MHH88_RS00670 | Genome accession | NZ_CP150264 |
| Coordinates | 126741..127250 (+) | Length | 169 a.a. |
| NCBI ID | WP_339260930.1 | Uniprot ID | - |
| Organism | Lysinibacillus sp. FSL K6-3209 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 111637..159248 | 126741..127250 | within | 0 |
Gene organization within MGE regions
Location: 111637..159248
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MHH88_RS00525 (MHH88_00525) | - | 111637..112836 (-) | 1200 | WP_339260871.1 | tyrosine-type recombinase/integrase | - |
| MHH88_RS00530 (MHH88_00530) | - | 112870..113358 (-) | 489 | WP_339260873.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MHH88_RS00535 (MHH88_00535) | - | 113463..113864 (-) | 402 | WP_339260875.1 | helix-turn-helix transcriptional regulator | - |
| MHH88_RS00540 (MHH88_00540) | - | 114009..114230 (+) | 222 | WP_339260877.1 | helix-turn-helix transcriptional regulator | - |
| MHH88_RS00545 (MHH88_00545) | - | 114261..114527 (+) | 267 | WP_339260879.1 | helix-turn-helix transcriptional regulator | - |
| MHH88_RS00550 (MHH88_00550) | - | 114733..115500 (+) | 768 | WP_339260881.1 | ORF6C domain-containing protein | - |
| MHH88_RS00555 (MHH88_00555) | - | 115502..115726 (+) | 225 | WP_339260883.1 | hypothetical protein | - |
| MHH88_RS00560 (MHH88_00560) | - | 115744..115974 (+) | 231 | WP_339260885.1 | hypothetical protein | - |
| MHH88_RS00565 (MHH88_00565) | - | 116015..116311 (+) | 297 | WP_339260887.1 | hypothetical protein | - |
| MHH88_RS00570 (MHH88_00570) | - | 116463..116756 (+) | 294 | WP_339260889.1 | helix-turn-helix transcriptional regulator | - |
| MHH88_RS00575 (MHH88_00575) | - | 116744..116998 (+) | 255 | WP_339260891.1 | hypothetical protein | - |
| MHH88_RS00580 (MHH88_00580) | - | 116982..117116 (+) | 135 | WP_339260893.1 | hypothetical protein | - |
| MHH88_RS00585 (MHH88_00585) | - | 117193..117366 (+) | 174 | WP_339260895.1 | hypothetical protein | - |
| MHH88_RS00590 (MHH88_00590) | - | 117547..119559 (+) | 2013 | WP_339260897.1 | AAA family ATPase | - |
| MHH88_RS00595 (MHH88_00595) | - | 119559..119813 (+) | 255 | WP_339260899.1 | hypothetical protein | - |
| MHH88_RS00600 (MHH88_00600) | - | 119831..120775 (+) | 945 | WP_339260901.1 | RecT family recombinase | - |
| MHH88_RS00605 (MHH88_00605) | - | 120797..121252 (+) | 456 | WP_339260903.1 | hypothetical protein | - |
| MHH88_RS00610 (MHH88_00610) | - | 121227..121928 (+) | 702 | WP_339260905.1 | MBL fold metallo-hydrolase | - |
| MHH88_RS00615 (MHH88_00615) | - | 121940..122302 (+) | 363 | WP_339260907.1 | hypothetical protein | - |
| MHH88_RS00620 (MHH88_00620) | - | 122353..122997 (+) | 645 | WP_339260909.1 | hypothetical protein | - |
| MHH88_RS00625 (MHH88_00625) | - | 123009..123371 (+) | 363 | WP_339260911.1 | hypothetical protein | - |
| MHH88_RS00630 (MHH88_00630) | - | 123387..123614 (+) | 228 | WP_339260913.1 | hypothetical protein | - |
| MHH88_RS00635 (MHH88_00635) | - | 123630..124421 (+) | 792 | WP_339260915.1 | DnaD domain protein | - |
| MHH88_RS00640 (MHH88_00640) | - | 124369..125175 (+) | 807 | WP_339260917.1 | DnaA/Hda family protein | - |
| MHH88_RS00645 (MHH88_00645) | - | 125211..125501 (+) | 291 | WP_339260920.1 | hypothetical protein | - |
| MHH88_RS00650 (MHH88_00650) | - | 125501..125893 (+) | 393 | WP_339260922.1 | hypothetical protein | - |
| MHH88_RS00655 (MHH88_00655) | - | 125886..126074 (+) | 189 | WP_107896602.1 | hypothetical protein | - |
| MHH88_RS00660 (MHH88_00660) | - | 126071..126472 (+) | 402 | WP_339260926.1 | YopX family protein | - |
| MHH88_RS00665 (MHH88_00665) | - | 126469..126744 (+) | 276 | WP_339260928.1 | hypothetical protein | - |
| MHH88_RS00670 (MHH88_00670) | ssbA | 126741..127250 (+) | 510 | WP_339260930.1 | single-stranded DNA-binding protein | Machinery gene |
| MHH88_RS00675 (MHH88_00675) | - | 127273..127452 (+) | 180 | WP_339260932.1 | hypothetical protein | - |
| MHH88_RS00680 (MHH88_00680) | - | 127449..128045 (+) | 597 | WP_339260934.1 | dUTP diphosphatase | - |
| MHH88_RS00685 (MHH88_00685) | - | 128054..128233 (+) | 180 | WP_339260936.1 | LuxR C-terminal-related transcriptional regulator | - |
| MHH88_RS00690 (MHH88_00690) | - | 128310..128963 (+) | 654 | WP_339260938.1 | hypothetical protein | - |
| MHH88_RS00695 (MHH88_00695) | - | 128960..129385 (+) | 426 | WP_339260940.1 | RusA family crossover junction endodeoxyribonuclease | - |
| MHH88_RS00700 (MHH88_00700) | - | 129370..129624 (+) | 255 | WP_339260942.1 | helix-turn-helix domain-containing protein | - |
| MHH88_RS00705 (MHH88_00705) | - | 129656..129919 (+) | 264 | WP_339260944.1 | hypothetical protein | - |
| MHH88_RS00710 (MHH88_00710) | - | 130304..130741 (+) | 438 | WP_339260946.1 | hypothetical protein | - |
| MHH88_RS00715 (MHH88_00715) | - | 130894..131808 (+) | 915 | WP_339260948.1 | potassium channel family protein | - |
| MHH88_RS00720 (MHH88_00720) | - | 132403..132654 (+) | 252 | WP_339260950.1 | hypothetical protein | - |
| MHH88_RS00725 (MHH88_00725) | - | 132823..133185 (+) | 363 | WP_339260952.1 | hypothetical protein | - |
| MHH88_RS00730 (MHH88_00730) | - | 133319..133633 (+) | 315 | WP_339260954.1 | hypothetical protein | - |
| MHH88_RS00735 (MHH88_00735) | - | 133704..134579 (+) | 876 | WP_339260956.1 | terminase small subunit | - |
| MHH88_RS00740 (MHH88_00740) | - | 134569..135834 (+) | 1266 | WP_339262970.1 | PBSX family phage terminase large subunit | - |
| MHH88_RS00745 (MHH88_00745) | - | 135849..137354 (+) | 1506 | WP_339260957.1 | phage portal protein | - |
| MHH88_RS00750 (MHH88_00750) | - | 137452..138573 (+) | 1122 | WP_339260959.1 | minor capsid protein | - |
| MHH88_RS00755 (MHH88_00755) | - | 138818..139423 (+) | 606 | WP_339260961.1 | phage scaffolding protein | - |
| MHH88_RS00760 (MHH88_00760) | - | 139443..139757 (+) | 315 | WP_339260963.1 | hypothetical protein | - |
| MHH88_RS00765 (MHH88_00765) | - | 139774..140829 (+) | 1056 | WP_339260965.1 | major capsid protein | - |
| MHH88_RS00770 (MHH88_00770) | - | 140844..141020 (+) | 177 | WP_339260967.1 | hypothetical protein | - |
| MHH88_RS00775 (MHH88_00775) | - | 141026..141421 (+) | 396 | WP_339260968.1 | hypothetical protein | - |
| MHH88_RS00780 (MHH88_00780) | - | 141469..141777 (+) | 309 | WP_339260970.1 | hypothetical protein | - |
| MHH88_RS00785 (MHH88_00785) | - | 141777..142196 (+) | 420 | WP_339260972.1 | HK97 gp10 family phage protein | - |
| MHH88_RS00790 (MHH88_00790) | - | 142186..142623 (+) | 438 | WP_339260974.1 | DUF6838 family protein | - |
| MHH88_RS00795 (MHH88_00795) | - | 142616..142843 (+) | 228 | WP_339260976.1 | hypothetical protein | - |
| MHH88_RS00800 (MHH88_00800) | - | 142845..144167 (+) | 1323 | WP_339260978.1 | phage tail sheath family protein | - |
| MHH88_RS00805 (MHH88_00805) | - | 144182..144697 (+) | 516 | WP_339260980.1 | phage tail tube protein | - |
| MHH88_RS00810 (MHH88_00810) | - | 144758..145183 (+) | 426 | WP_339260982.1 | phage portal protein | - |
| MHH88_RS00815 (MHH88_00815) | - | 145210..145371 (+) | 162 | WP_339260984.1 | hypothetical protein | - |
| MHH88_RS00820 (MHH88_00820) | - | 145445..146164 (+) | 720 | WP_339260986.1 | hypothetical protein | - |
| MHH88_RS00825 (MHH88_00825) | - | 146179..148485 (+) | 2307 | WP_339260988.1 | tape measure protein | - |
| MHH88_RS00830 (MHH88_00830) | - | 148478..149158 (+) | 681 | WP_339260990.1 | LysM peptidoglycan-binding domain-containing protein | - |
| MHH88_RS00835 (MHH88_00835) | - | 149151..150113 (+) | 963 | WP_339260992.1 | hydrolase | - |
| MHH88_RS00840 (MHH88_00840) | - | 150115..150441 (+) | 327 | WP_339260994.1 | DUF2577 domain-containing protein | - |
| MHH88_RS00845 (MHH88_00845) | - | 150441..150845 (+) | 405 | WP_339260996.1 | DUF2634 domain-containing protein | - |
| MHH88_RS00850 (MHH88_00850) | - | 150845..151936 (+) | 1092 | WP_339260998.1 | baseplate J/gp47 family protein | - |
| MHH88_RS00855 (MHH88_00855) | - | 151929..152477 (+) | 549 | WP_339261000.1 | putative phage tail protein | - |
| MHH88_RS00860 (MHH88_00860) | - | 152477..153088 (+) | 612 | WP_339261002.1 | hypothetical protein | - |
| MHH88_RS00865 (MHH88_00865) | - | 153109..153369 (+) | 261 | WP_339261004.1 | hypothetical protein | - |
| MHH88_RS00870 (MHH88_00870) | - | 153372..153545 (+) | 174 | WP_339261006.1 | hypothetical protein | - |
| MHH88_RS00875 (MHH88_00875) | - | 153603..153911 (+) | 309 | WP_339261008.1 | hemolysin XhlA family protein | - |
| MHH88_RS00880 (MHH88_00880) | - | 153924..154181 (+) | 258 | WP_339261010.1 | phage holin | - |
| MHH88_RS00885 (MHH88_00885) | - | 154181..154864 (+) | 684 | WP_339261012.1 | N-acetylmuramoyl-L-alanine amidase family protein | - |
| MHH88_RS00890 (MHH88_00890) | - | 155071..155979 (+) | 909 | WP_339261014.1 | ATP-binding protein | - |
| MHH88_RS00895 (MHH88_00895) | - | 155970..156269 (+) | 300 | WP_339261016.1 | STAS-like domain-containing protein | - |
| MHH88_RS00900 (MHH88_00900) | - | 156388..156708 (+) | 321 | WP_339261018.1 | YolD-like family protein | - |
| MHH88_RS00905 (MHH88_00905) | - | 156748..157065 (+) | 318 | WP_339261020.1 | YolD-like family protein | - |
| MHH88_RS00910 (MHH88_00910) | - | 157058..157426 (+) | 369 | WP_339261022.1 | aconitate hydratase | - |
| MHH88_RS00915 (MHH88_00915) | - | 157407..157694 (+) | 288 | WP_339261024.1 | hypothetical protein | - |
| MHH88_RS00920 (MHH88_00920) | - | 158238..159248 (+) | 1011 | WP_339261026.1 | Abi family protein | - |
Sequence
Protein
Download Length: 169 a.a. Molecular weight: 18529.30 Da Isoelectric Point: 5.2477
>NTDB_id=968630 MHH88_RS00670 WP_339260930.1 126741..127250(+) (ssbA) [Lysinibacillus sp. FSL K6-3209]
MINRTVIVGRLVADPELRYTPSGIASCKFRVAVNRTFKGQNGEQEADFISCIAWRKQAENLANFMKKGNLIGLEGRIQTG
SYEGQDGKRVYTTDVVADSIQFLEPRNSAGSSQSTSNYQSSTNTGGTYQNPPQGNYGGNNNQSNYTRVDEDPFANSKGPI
EVNSDDLPF
MINRTVIVGRLVADPELRYTPSGIASCKFRVAVNRTFKGQNGEQEADFISCIAWRKQAENLANFMKKGNLIGLEGRIQTG
SYEGQDGKRVYTTDVVADSIQFLEPRNSAGSSQSTSNYQSSTNTGGTYQNPPQGNYGGNNNQSNYTRVDEDPFANSKGPI
EVNSDDLPF
Nucleotide
Download Length: 510 bp
>NTDB_id=968630 MHH88_RS00670 WP_339260930.1 126741..127250(+) (ssbA) [Lysinibacillus sp. FSL K6-3209]
ATGATTAACCGCACTGTCATCGTTGGAAGATTGGTTGCTGATCCGGAGCTCCGTTATACTCCGTCAGGCATTGCCTCTTG
TAAGTTCCGAGTAGCCGTCAATAGAACATTCAAAGGACAAAACGGTGAACAAGAAGCTGATTTCATTAGTTGCATAGCTT
GGCGTAAACAAGCCGAGAATCTAGCTAACTTCATGAAAAAAGGAAATTTAATAGGTTTGGAAGGGCGAATCCAAACAGGT
AGCTATGAGGGGCAGGATGGCAAGCGTGTATACACTACTGACGTTGTAGCCGACAGCATCCAATTCTTAGAGCCAAGAAA
CAGCGCAGGAAGCTCACAGAGCACGTCAAACTATCAATCTAGTACAAATACAGGTGGAACGTATCAAAACCCACCACAGG
GCAATTATGGCGGTAATAACAACCAGTCAAATTATACAAGGGTGGATGAAGATCCGTTTGCGAATAGTAAAGGGCCGATT
GAGGTCAATTCTGACGATTTACCTTTCTAA
ATGATTAACCGCACTGTCATCGTTGGAAGATTGGTTGCTGATCCGGAGCTCCGTTATACTCCGTCAGGCATTGCCTCTTG
TAAGTTCCGAGTAGCCGTCAATAGAACATTCAAAGGACAAAACGGTGAACAAGAAGCTGATTTCATTAGTTGCATAGCTT
GGCGTAAACAAGCCGAGAATCTAGCTAACTTCATGAAAAAAGGAAATTTAATAGGTTTGGAAGGGCGAATCCAAACAGGT
AGCTATGAGGGGCAGGATGGCAAGCGTGTATACACTACTGACGTTGTAGCCGACAGCATCCAATTCTTAGAGCCAAGAAA
CAGCGCAGGAAGCTCACAGAGCACGTCAAACTATCAATCTAGTACAAATACAGGTGGAACGTATCAAAACCCACCACAGG
GCAATTATGGCGGTAATAACAACCAGTCAAATTATACAAGGGTGGATGAAGATCCGTTTGCGAATAGTAAAGGGCCGATT
GAGGTCAATTCTGACGATTTACCTTTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
51.163 |
100 |
0.521 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
48.571 |
100 |
0.503 |