Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   MKY56_RS12650 Genome accession   NZ_CP150257
Coordinates   2437943..2438326 (-) Length   127 a.a.
NCBI ID   WP_046160582.1    Uniprot ID   A0AA96UKP5
Organism   Bacillus sp. FSL M8-0054     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2432943..2443326
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MKY56_RS12610 (MKY56_12610) sinI 2433876..2434049 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  MKY56_RS12615 (MKY56_12615) sinR 2434083..2434418 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  MKY56_RS12620 (MKY56_12620) tasA 2434511..2435296 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  MKY56_RS12625 (MKY56_12625) - 2435360..2435932 (-) 573 WP_003230181.1 signal peptidase I -
  MKY56_RS12630 (MKY56_12630) tapA 2435916..2436677 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  MKY56_RS12635 (MKY56_12635) - 2436949..2437275 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  MKY56_RS12640 (MKY56_12640) - 2437317..2437496 (-) 180 WP_029726723.1 YqzE family protein -
  MKY56_RS12645 (MKY56_12645) comGG 2437568..2437942 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  MKY56_RS12650 (MKY56_12650) comGF 2437943..2438326 (-) 384 WP_046160582.1 ComG operon protein ComGF Machinery gene
  MKY56_RS12655 (MKY56_12655) comGE 2438352..2438699 (-) 348 WP_046381178.1 ComG operon protein 5 Machinery gene
  MKY56_RS12660 (MKY56_12660) comGD 2438683..2439114 (-) 432 WP_046381179.1 comG operon protein ComGD Machinery gene
  MKY56_RS12665 (MKY56_12665) comGC 2439104..2439400 (-) 297 WP_014477332.1 comG operon protein ComGC Machinery gene
  MKY56_RS12670 (MKY56_12670) comGB 2439414..2440451 (-) 1038 WP_029317912.1 comG operon protein ComGB Machinery gene
  MKY56_RS12675 (MKY56_12675) comGA 2440438..2441508 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  MKY56_RS12680 (MKY56_12680) - 2441720..2441917 (-) 198 WP_014480259.1 CBS domain-containing protein -
  MKY56_RS12685 (MKY56_12685) corA 2441919..2442872 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14306.38 Da        Isoelectric Point: 5.5289

>NTDB_id=968232 MKY56_RS12650 WP_046160582.1 2437943..2438326(-) (comGF) [Bacillus sp. FSL M8-0054]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYQSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=968232 MKY56_RS12650 WP_046160582.1 2437943..2438326(-) (comGF) [Bacillus sp. FSL M8-0054]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCAATCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984


Multiple sequence alignment