Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   MKY56_RS12610 Genome accession   NZ_CP150257
Coordinates   2433876..2434049 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus sp. FSL M8-0054     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2428876..2439049
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MKY56_RS12595 (MKY56_12595) gcvT 2429675..2430763 (-) 1089 WP_163130630.1 glycine cleavage system aminomethyltransferase GcvT -
  MKY56_RS12600 (MKY56_12600) - 2431205..2432878 (+) 1674 WP_047182869.1 SNF2-related protein -
  MKY56_RS12605 (MKY56_12605) - 2432899..2433693 (+) 795 WP_076458108.1 YqhG family protein -
  MKY56_RS12610 (MKY56_12610) sinI 2433876..2434049 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  MKY56_RS12615 (MKY56_12615) sinR 2434083..2434418 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  MKY56_RS12620 (MKY56_12620) tasA 2434511..2435296 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  MKY56_RS12625 (MKY56_12625) - 2435360..2435932 (-) 573 WP_003230181.1 signal peptidase I -
  MKY56_RS12630 (MKY56_12630) tapA 2435916..2436677 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  MKY56_RS12635 (MKY56_12635) - 2436949..2437275 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  MKY56_RS12640 (MKY56_12640) - 2437317..2437496 (-) 180 WP_029726723.1 YqzE family protein -
  MKY56_RS12645 (MKY56_12645) comGG 2437568..2437942 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  MKY56_RS12650 (MKY56_12650) comGF 2437943..2438326 (-) 384 WP_046160582.1 ComG operon protein ComGF Machinery gene
  MKY56_RS12655 (MKY56_12655) comGE 2438352..2438699 (-) 348 WP_046381178.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=968229 MKY56_RS12610 WP_003230187.1 2433876..2434049(+) (sinI) [Bacillus sp. FSL M8-0054]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=968229 MKY56_RS12610 WP_003230187.1 2433876..2434049(+) (sinI) [Bacillus sp. FSL M8-0054]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment