Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   MKX71_RS12255 Genome accession   NZ_CP150256
Coordinates   2411435..2411608 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus sp. FSL M8-0071     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2406435..2416608
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MKX71_RS12240 (MKX71_12240) gcvT 2407235..2408323 (-) 1089 WP_339231175.1 glycine cleavage system aminomethyltransferase GcvT -
  MKX71_RS12245 (MKX71_12245) - 2408765..2410438 (+) 1674 WP_029726726.1 SNF2-related protein -
  MKX71_RS12250 (MKX71_12250) - 2410459..2411253 (+) 795 WP_003230200.1 YqhG family protein -
  MKX71_RS12255 (MKX71_12255) sinI 2411435..2411608 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  MKX71_RS12260 (MKX71_12260) sinR 2411642..2411977 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  MKX71_RS12265 (MKX71_12265) tasA 2412070..2412855 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  MKX71_RS12270 (MKX71_12270) - 2412919..2413491 (-) 573 WP_003230181.1 signal peptidase I -
  MKX71_RS12275 (MKX71_12275) tapA 2413475..2414236 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  MKX71_RS12280 (MKX71_12280) - 2414508..2414834 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  MKX71_RS12285 (MKX71_12285) - 2414876..2415055 (-) 180 WP_029726723.1 YqzE family protein -
  MKX71_RS12290 (MKX71_12290) comGG 2415127..2415501 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  MKX71_RS12295 (MKX71_12295) comGF 2415502..2415885 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  MKX71_RS12300 (MKX71_12300) comGE 2415911..2416258 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=968150 MKX71_RS12255 WP_003230187.1 2411435..2411608(+) (sinI) [Bacillus sp. FSL M8-0071]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=968150 MKX71_RS12255 WP_003230187.1 2411435..2411608(+) (sinI) [Bacillus sp. FSL M8-0071]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment