Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   MKX71_RS12290 Genome accession   NZ_CP150256
Coordinates   2415127..2415501 (-) Length   124 a.a.
NCBI ID   WP_014480253.1    Uniprot ID   A0AA96ZSW7
Organism   Bacillus sp. FSL M8-0071     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2410127..2420501
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MKX71_RS12250 (MKX71_12250) - 2410459..2411253 (+) 795 WP_003230200.1 YqhG family protein -
  MKX71_RS12255 (MKX71_12255) sinI 2411435..2411608 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  MKX71_RS12260 (MKX71_12260) sinR 2411642..2411977 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  MKX71_RS12265 (MKX71_12265) tasA 2412070..2412855 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  MKX71_RS12270 (MKX71_12270) - 2412919..2413491 (-) 573 WP_003230181.1 signal peptidase I -
  MKX71_RS12275 (MKX71_12275) tapA 2413475..2414236 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  MKX71_RS12280 (MKX71_12280) - 2414508..2414834 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  MKX71_RS12285 (MKX71_12285) - 2414876..2415055 (-) 180 WP_029726723.1 YqzE family protein -
  MKX71_RS12290 (MKX71_12290) comGG 2415127..2415501 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  MKX71_RS12295 (MKX71_12295) comGF 2415502..2415885 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  MKX71_RS12300 (MKX71_12300) comGE 2415911..2416258 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  MKX71_RS12305 (MKX71_12305) comGD 2416242..2416673 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  MKX71_RS12310 (MKX71_12310) comGC 2416663..2416959 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  MKX71_RS12315 (MKX71_12315) comGB 2416973..2418010 (-) 1038 WP_029317912.1 comG operon protein ComGB Machinery gene
  MKX71_RS12320 (MKX71_12320) comGA 2417997..2419067 (-) 1071 WP_069322755.1 competence protein ComGA Machinery gene
  MKX71_RS12325 (MKX71_12325) - 2419279..2419401 (-) 123 Protein_2377 hypothetical protein -
  MKX71_RS12330 (MKX71_12330) corA 2419478..2420431 (-) 954 WP_015483432.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14509.72 Da        Isoelectric Point: 9.2806

>NTDB_id=968152 MKX71_RS12290 WP_014480253.1 2415127..2415501(-) (comGG) [Bacillus sp. FSL M8-0071]
MYRTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=968152 MKX71_RS12290 WP_014480253.1 2415127..2415501(-) (comGG) [Bacillus sp. FSL M8-0071]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAAAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTGTTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

97.581

100

0.976

Multiple sequence alignment