Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NYE20_RS17315 Genome accession   NZ_CP150252
Coordinates   3237207..3237347 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus sp. FSL R5-0416     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3232207..3242347
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NYE20_RS17290 (NYE20_17290) - 3232529..3232909 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  NYE20_RS17295 (NYE20_17295) comA 3232928..3233572 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  NYE20_RS17300 (NYE20_17300) comP 3233653..3235971 (-) 2319 WP_161621287.1 sensor histidine kinase Regulator
  NYE20_RS17305 (NYE20_17305) comX 3235991..3236167 (-) 177 WP_041906074.1 competence pheromone ComX -
  NYE20_RS17310 (NYE20_17310) - 3236182..3237039 (-) 858 WP_309248341.1 polyprenyl synthetase family protein -
  NYE20_RS17315 (NYE20_17315) degQ 3237207..3237347 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  NYE20_RS17320 (NYE20_17320) - 3237569..3237694 (+) 126 WP_161621781.1 hypothetical protein -
  NYE20_RS17325 (NYE20_17325) - 3237810..3238178 (+) 369 WP_017695529.1 hypothetical protein -
  NYE20_RS17330 (NYE20_17330) pdeH 3238154..3239383 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  NYE20_RS17335 (NYE20_17335) - 3239520..3240992 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  NYE20_RS17340 (NYE20_17340) - 3241008..3241559 (-) 552 WP_015714627.1 isochorismatase family cysteine hydrolase -
  NYE20_RS17345 (NYE20_17345) - 3241656..3242054 (-) 399 WP_015714628.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=967905 NYE20_RS17315 WP_003220708.1 3237207..3237347(-) (degQ) [Bacillus sp. FSL R5-0416]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=967905 NYE20_RS17315 WP_003220708.1 3237207..3237347(-) (degQ) [Bacillus sp. FSL R5-0416]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment