Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   NYE53_RS12300 Genome accession   NZ_CP150251
Coordinates   2422450..2422833 (-) Length   127 a.a.
NCBI ID   WP_106073563.1    Uniprot ID   -
Organism   Bacillus sp. FSL R5-0523     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2417450..2427833
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NYE53_RS12260 (NYE53_12260) sinI 2418383..2418556 (+) 174 WP_339244940.1 anti-repressor SinI family protein Regulator
  NYE53_RS12265 (NYE53_12265) sinR 2418590..2418925 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NYE53_RS12270 (NYE53_12270) tasA 2419018..2419803 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  NYE53_RS12275 (NYE53_12275) - 2419868..2420440 (-) 573 WP_003246088.1 signal peptidase I -
  NYE53_RS12280 (NYE53_12280) tapA 2420424..2421185 (-) 762 WP_339244943.1 amyloid fiber anchoring/assembly protein TapA -
  NYE53_RS12285 (NYE53_12285) - 2421456..2421782 (+) 327 WP_339244945.1 YqzG/YhdC family protein -
  NYE53_RS12290 (NYE53_12290) - 2421824..2422003 (-) 180 WP_014480252.1 YqzE family protein -
  NYE53_RS12295 (NYE53_12295) comGG 2422075..2422449 (-) 375 WP_339244947.1 ComG operon protein ComGG Machinery gene
  NYE53_RS12300 (NYE53_12300) comGF 2422450..2422833 (-) 384 WP_106073563.1 ComG operon protein ComGF Machinery gene
  NYE53_RS12305 (NYE53_12305) comGE 2422859..2423206 (-) 348 WP_327829299.1 ComG operon protein 5 Machinery gene
  NYE53_RS12310 (NYE53_12310) comGD 2423190..2423621 (-) 432 WP_080529538.1 comG operon protein ComGD Machinery gene
  NYE53_RS12315 (NYE53_12315) comGC 2423611..2423907 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  NYE53_RS12320 (NYE53_12320) comGB 2423921..2424958 (-) 1038 WP_327829298.1 comG operon protein ComGB Machinery gene
  NYE53_RS12325 (NYE53_12325) comGA 2424945..2426015 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  NYE53_RS12330 (NYE53_12330) - 2426226..2426423 (-) 198 WP_327829297.1 hypothetical protein -
  NYE53_RS12335 (NYE53_12335) corA 2426425..2427378 (-) 954 WP_015483432.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14349.41 Da        Isoelectric Point: 5.8929

>NTDB_id=967804 NYE53_RS12300 WP_106073563.1 2422450..2422833(-) (comGF) [Bacillus sp. FSL R5-0523]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADFENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=967804 NYE53_RS12300 WP_106073563.1 2422450..2422833(-) (comGF) [Bacillus sp. FSL R5-0523]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984


Multiple sequence alignment