Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   NYE53_RS12260 Genome accession   NZ_CP150251
Coordinates   2418383..2418556 (+) Length   57 a.a.
NCBI ID   WP_339244940.1    Uniprot ID   -
Organism   Bacillus sp. FSL R5-0523     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2413383..2423556
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NYE53_RS12245 (NYE53_12245) gcvT 2414182..2415270 (-) 1089 WP_339244936.1 glycine cleavage system aminomethyltransferase GcvT -
  NYE53_RS12250 (NYE53_12250) - 2415711..2417384 (+) 1674 WP_339244937.1 SNF2-related protein -
  NYE53_RS12255 (NYE53_12255) - 2417405..2418199 (+) 795 WP_003230200.1 YqhG family protein -
  NYE53_RS12260 (NYE53_12260) sinI 2418383..2418556 (+) 174 WP_339244940.1 anti-repressor SinI family protein Regulator
  NYE53_RS12265 (NYE53_12265) sinR 2418590..2418925 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NYE53_RS12270 (NYE53_12270) tasA 2419018..2419803 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  NYE53_RS12275 (NYE53_12275) - 2419868..2420440 (-) 573 WP_003246088.1 signal peptidase I -
  NYE53_RS12280 (NYE53_12280) tapA 2420424..2421185 (-) 762 WP_339244943.1 amyloid fiber anchoring/assembly protein TapA -
  NYE53_RS12285 (NYE53_12285) - 2421456..2421782 (+) 327 WP_339244945.1 YqzG/YhdC family protein -
  NYE53_RS12290 (NYE53_12290) - 2421824..2422003 (-) 180 WP_014480252.1 YqzE family protein -
  NYE53_RS12295 (NYE53_12295) comGG 2422075..2422449 (-) 375 WP_339244947.1 ComG operon protein ComGG Machinery gene
  NYE53_RS12300 (NYE53_12300) comGF 2422450..2422833 (-) 384 WP_106073563.1 ComG operon protein ComGF Machinery gene
  NYE53_RS12305 (NYE53_12305) comGE 2422859..2423206 (-) 348 WP_327829299.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6605.52 Da        Isoelectric Point: 6.2115

>NTDB_id=967801 NYE53_RS12260 WP_339244940.1 2418383..2418556(+) (sinI) [Bacillus sp. FSL R5-0523]
MKNAKQEHFELDQEWVELMMEAKEANISPEEIQKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=967801 NYE53_RS12260 WP_339244940.1 2418383..2418556(+) (sinI) [Bacillus sp. FSL R5-0523]
ATGAAAAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTGATGATGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACAAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

96.491

100

0.965


Multiple sequence alignment