Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   NYE32_RS08765 Genome accession   NZ_CP150201
Coordinates   1922069..1922587 (-) Length   172 a.a.
NCBI ID   WP_002891844.1    Uniprot ID   A0AB33ZBY1
Organism   Streptococcus sp. FSL R7-0248     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1896432..1965735 1922069..1922587 within 0


Gene organization within MGE regions


Location: 1896432..1965735
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NYE32_RS08635 (NYE32_08635) acpS 1896655..1897008 (-) 354 WP_002891813.1 holo-ACP synthase -
  NYE32_RS08640 (NYE32_08640) - 1897011..1898042 (-) 1032 WP_073689905.1 3-deoxy-7-phosphoheptulonate synthase -
  NYE32_RS08645 (NYE32_08645) - 1898127..1899158 (-) 1032 WP_002891816.1 3-deoxy-7-phosphoheptulonate synthase -
  NYE32_RS08650 (NYE32_08650) secA 1899179..1901728 (-) 2550 WP_004183450.1 preprotein translocase subunit SecA -
  NYE32_RS08655 (NYE32_08655) - 1901911..1902255 (-) 345 WP_241672425.1 hypothetical protein -
  NYE32_RS08660 (NYE32_08660) manA 1902258..1903205 (-) 948 WP_070437949.1 mannose-6-phosphate isomerase, class I -
  NYE32_RS08665 (NYE32_08665) scrK 1903271..1904164 (-) 894 WP_004183453.1 fructokinase ScrK -
  NYE32_RS08670 (NYE32_08670) - 1904345..1906246 (-) 1902 WP_139723691.1 sucrose-specific PTS transporter subunit IIBC -
  NYE32_RS08675 (NYE32_08675) - 1906435..1907877 (+) 1443 WP_070437955.1 sucrose-6-phosphate hydrolase -
  NYE32_RS08680 (NYE32_08680) - 1907886..1908851 (+) 966 WP_070437958.1 LacI family DNA-binding transcriptional regulator -
  NYE32_RS08685 (NYE32_08685) nusB 1908942..1909376 (-) 435 WP_002884506.1 transcription antitermination factor NusB -
  NYE32_RS08690 (NYE32_08690) - 1909369..1909758 (-) 390 WP_002884704.1 Asp23/Gls24 family envelope stress response protein -
  NYE32_RS08695 (NYE32_08695) efp 1909829..1910389 (-) 561 WP_002891830.1 elongation factor P -
  NYE32_RS08700 (NYE32_08700) - 1910505..1910960 (-) 456 WP_002884736.1 deaminase -
  NYE32_RS08705 (NYE32_08705) - 1910979..1912040 (-) 1062 WP_070437964.1 Xaa-Pro peptidase family protein -
  NYE32_RS08710 (NYE32_08710) - 1912173..1912895 (-) 723 WP_247924742.1 hypothetical protein -
  NYE32_RS08715 (NYE32_08715) - 1912885..1913706 (-) 822 WP_037599087.1 ATP-binding cassette domain-containing protein -
  NYE32_RS08720 (NYE32_08720) - 1913835..1914695 (-) 861 WP_070437967.1 thioredoxin family protein -
  NYE32_RS08725 (NYE32_08725) - 1914963..1915163 (-) 201 WP_037602602.1 hypothetical protein -
  NYE32_RS08730 (NYE32_08730) - 1915200..1915349 (-) 150 WP_171966959.1 hypothetical protein -
  NYE32_RS08735 (NYE32_08735) - 1915524..1915766 (-) 243 WP_037602605.1 DUF3923 family protein -
  NYE32_RS08740 (NYE32_08740) uvrA 1915862..1918687 (-) 2826 WP_073949518.1 excinuclease ABC subunit UvrA -
  NYE32_RS08745 (NYE32_08745) - 1918982..1919926 (+) 945 WP_004183470.1 magnesium transporter CorA family protein -
  NYE32_RS08750 (NYE32_08750) - 1919995..1920666 (+) 672 WP_002891841.1 DUF1129 domain-containing protein -
  NYE32_RS08755 (NYE32_08755) - 1920783..1921664 (+) 882 WP_002891843.1 DUF4300 family protein -
  NYE32_RS08760 (NYE32_08760) rpsR 1921788..1922027 (-) 240 WP_000068665.1 30S ribosomal protein S18 -
  NYE32_RS08765 (NYE32_08765) ssb 1922069..1922587 (-) 519 WP_002891844.1 single-stranded DNA-binding protein Machinery gene
  NYE32_RS08770 (NYE32_08770) rpsF 1922599..1922889 (-) 291 WP_003093185.1 30S ribosomal protein S6 -
  NYE32_RS08775 (NYE32_08775) - 1923322..1924638 (-) 1317 WP_339156996.1 ISLre2 family transposase -
  NYE32_RS08780 (NYE32_08780) - 1924718..1924942 (-) 225 WP_037600143.1 hypothetical protein -
  NYE32_RS08785 (NYE32_08785) - 1924997..1925788 (-) 792 WP_037600145.1 ParA family protein -
  NYE32_RS08790 (NYE32_08790) - 1925953..1926342 (-) 390 WP_037600146.1 hypothetical protein -
  NYE32_RS08795 (NYE32_08795) - 1927179..1927763 (-) 585 WP_037599279.1 recombinase family protein -
  NYE32_RS08800 (NYE32_08800) - 1927874..1928557 (-) 684 WP_339156998.1 hypothetical protein -
  NYE32_RS08805 (NYE32_08805) - 1928635..1928829 (-) 195 WP_049546106.1 hypothetical protein -
  NYE32_RS08810 (NYE32_08810) - 1928890..1930407 (-) 1518 WP_339156999.1 relaxase/mobilization nuclease domain-containing protein -
  NYE32_RS08815 (NYE32_08815) mobC 1930496..1930870 (-) 375 WP_175062656.1 plasmid mobilization relaxosome protein MobC -
  NYE32_RS08820 (NYE32_08820) - 1931327..1931629 (-) 303 WP_339157000.1 hypothetical protein -
  NYE32_RS08825 (NYE32_08825) - 1931708..1934941 (-) 3234 WP_339157001.1 PBECR4 domain-containing protein -
  NYE32_RS08830 (NYE32_08830) - 1934957..1936702 (-) 1746 WP_339157002.1 DNA topoisomerase -
  NYE32_RS08835 (NYE32_08835) - 1936715..1937890 (-) 1176 WP_037599287.1 JAB domain-containing protein -
  NYE32_RS08840 (NYE32_08840) - 1937965..1938120 (-) 156 WP_161800604.1 hypothetical protein -
  NYE32_RS08845 (NYE32_08845) - 1938154..1940148 (-) 1995 WP_339157003.1 type IV secretory system conjugative DNA transfer family protein -
  NYE32_RS08850 (NYE32_08850) - 1940158..1940682 (-) 525 WP_339157004.1 DUF3801 domain-containing protein -
  NYE32_RS08855 (NYE32_08855) - 1940695..1941603 (-) 909 WP_049529246.1 hypothetical protein -
  NYE32_RS08860 (NYE32_08860) - 1941606..1941875 (-) 270 WP_201041049.1 hypothetical protein -
  NYE32_RS08865 (NYE32_08865) - 1941891..1942409 (-) 519 WP_339157005.1 hypothetical protein -
  NYE32_RS08870 (NYE32_08870) - 1942414..1943097 (-) 684 WP_316582198.1 hypothetical protein -
  NYE32_RS08875 (NYE32_08875) - 1943122..1945896 (-) 2775 WP_339157006.1 phage tail tip lysozyme -
  NYE32_RS08880 (NYE32_08880) - 1945951..1948359 (-) 2409 WP_339157007.1 DUF87 domain-containing protein -
  NYE32_RS08885 (NYE32_08885) - 1948392..1948634 (-) 243 WP_339157129.1 hypothetical protein -
  NYE32_RS08890 (NYE32_08890) - 1948585..1948962 (-) 378 WP_339157008.1 PrgI family protein -
  NYE32_RS08895 (NYE32_08895) - 1948977..1949726 (-) 750 WP_049529240.1 type IV secretion system protein -
  NYE32_RS08900 (NYE32_08900) - 1949789..1950154 (-) 366 WP_270537434.1 hypothetical protein -
  NYE32_RS08905 (NYE32_08905) - 1950231..1950458 (-) 228 WP_339157009.1 hypothetical protein -
  NYE32_RS08910 (NYE32_08910) - 1950779..1952458 (-) 1680 WP_339157010.1 LPXTG cell wall anchor domain-containing protein -
  NYE32_RS08915 (NYE32_08915) - 1952712..1953554 (-) 843 WP_339157011.1 LPXTG cell wall anchor domain-containing protein -
  NYE32_RS08920 (NYE32_08920) - 1953559..1953870 (-) 312 WP_339157012.1 hypothetical protein -
  NYE32_RS08925 (NYE32_08925) - 1954223..1954477 (-) 255 WP_339157013.1 hypothetical protein -
  NYE32_RS08930 (NYE32_08930) - 1954573..1955424 (-) 852 WP_339157126.1 replication initiator protein A -
  NYE32_RS08935 (NYE32_08935) - 1955452..1955580 (-) 129 Protein_1722 replication initiator protein A -
  NYE32_RS08940 (NYE32_08940) - 1955593..1955754 (-) 162 WP_048788320.1 hypothetical protein -
  NYE32_RS08945 (NYE32_08945) - 1955942..1956895 (+) 954 WP_070437972.1 hypothetical protein -
  NYE32_RS08950 (NYE32_08950) mutY 1958322..1959473 (+) 1152 WP_070437975.1 A/G-specific adenine glycosylase -
  NYE32_RS08955 (NYE32_08955) - 1959495..1959620 (-) 126 WP_021143609.1 hypothetical protein -
  NYE32_RS08960 (NYE32_08960) - 1959769..1960866 (-) 1098 WP_155198302.1 DUF6287 domain-containing protein -
  NYE32_RS08965 (NYE32_08965) polA 1961283..1963922 (-) 2640 WP_156685218.1 DNA polymerase I -

Sequence


Protein


Download         Length: 172 a.a.        Molecular weight: 18594.32 Da        Isoelectric Point: 4.9163

>NTDB_id=966189 NYE32_RS08765 WP_002891844.1 1922069..1922587(-) (ssb) [Streptococcus sp. FSL R7-0248]
MINNVVLVGRMTRDAELRYTPSNVAVATFSLAVNRNFKGANGERETDFINCVIWRQQAENLANWAKKGALIGITGRIQTR
NYENQQGQRVYVTEVVADNFQMLESRAAREGHSGGSYNAGGFDNSNSFGGGASTGGSFGGSQPAQSTPNFGRDESPFGNS
NPMDISDDDLPF

Nucleotide


Download         Length: 519 bp        

>NTDB_id=966189 NYE32_RS08765 WP_002891844.1 1922069..1922587(-) (ssb) [Streptococcus sp. FSL R7-0248]
ATGATTAATAATGTCGTACTCGTTGGTCGCATGACCCGTGATGCGGAACTTCGTTATACACCAAGCAACGTTGCTGTTGC
AACATTTAGCCTTGCGGTTAACCGTAACTTCAAGGGTGCTAATGGTGAACGTGAAACAGACTTTATTAACTGTGTTATCT
GGCGCCAGCAAGCTGAAAATTTGGCTAACTGGGCTAAGAAAGGCGCATTGATTGGAATTACAGGTCGTATTCAGACTCGT
AACTATGAAAATCAACAAGGTCAACGTGTTTACGTAACTGAAGTTGTCGCTGATAATTTCCAAATGTTGGAAAGCCGTGC
GGCACGTGAAGGTCACAGTGGTGGTTCTTACAACGCTGGAGGATTTGATAATTCAAATTCATTCGGTGGTGGAGCTTCAA
CTGGTGGTTCATTTGGTGGATCACAACCTGCACAATCTACACCAAACTTCGGTCGTGATGAGAGTCCATTTGGTAATTCA
AATCCAATGGATATTTCAGATGACGATCTCCCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

58.046

100

0.587

  ssbA Bacillus subtilis subsp. subtilis str. 168

54.301

100

0.587

  ssb Glaesserella parasuis strain SC1401

32.461

100

0.36


Multiple sequence alignment