Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NST56_RS16970 Genome accession   NZ_CP150195
Coordinates   3210889..3211029 (-) Length   46 a.a.
NCBI ID   WP_010331694.1    Uniprot ID   A0AAP3CUJ5
Organism   Bacillus sp. FSL R5-0560     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3205889..3216029
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NST56_RS16945 (NST56_16945) - 3206232..3206612 (-) 381 WP_339177933.1 hotdog fold thioesterase -
  NST56_RS16950 (NST56_16950) comA 3206630..3207274 (-) 645 WP_010331690.1 two-component system response regulator ComA Regulator
  NST56_RS16955 (NST56_16955) comP 3207355..3209655 (-) 2301 WP_339177936.1 histidine kinase Regulator
  NST56_RS16960 (NST56_16960) comX 3209667..3209831 (-) 165 WP_268471515.1 competence pheromone ComX -
  NST56_RS16965 (NST56_16965) - 3209844..3210704 (-) 861 WP_268471516.1 polyprenyl synthetase family protein -
  NST56_RS16970 (NST56_16970) degQ 3210889..3211029 (-) 141 WP_010331694.1 degradation enzyme regulation protein DegQ Regulator
  NST56_RS16975 (NST56_16975) - 3211490..3211858 (+) 369 WP_010331695.1 hypothetical protein -
  NST56_RS16980 (NST56_16980) - 3211834..3213063 (-) 1230 WP_010331696.1 EAL and HDOD domain-containing protein -
  NST56_RS16985 (NST56_16985) - 3213199..3214668 (-) 1470 WP_010331697.1 nicotinate phosphoribosyltransferase -
  NST56_RS16990 (NST56_16990) - 3214684..3215235 (-) 552 WP_168748644.1 isochorismatase family cysteine hydrolase -
  NST56_RS16995 (NST56_16995) - 3215332..3215730 (-) 399 WP_168748645.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5517.44 Da        Isoelectric Point: 6.2565

>NTDB_id=965872 NST56_RS16970 WP_010331694.1 3210889..3211029(-) (degQ) [Bacillus sp. FSL R5-0560]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKFTYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=965872 NST56_RS16970 WP_010331694.1 3210889..3211029(-) (degQ) [Bacillus sp. FSL R5-0560]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCACATACGCAATGAAAATTTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

95.652

100

0.957

Multiple sequence alignment