Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   NSQ42_RS12445 Genome accession   NZ_CP150184
Coordinates   2415772..2415945 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus sp. FSL W8-0812     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2410772..2420945
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NSQ42_RS12430 (NSQ42_12430) gcvT 2411571..2412659 (-) 1089 WP_015714248.1 glycine cleavage system aminomethyltransferase GcvT -
  NSQ42_RS12435 (NSQ42_12435) - 2413101..2414774 (+) 1674 WP_029726726.1 SNF2-related protein -
  NSQ42_RS12440 (NSQ42_12440) - 2414795..2415589 (+) 795 WP_003230200.1 YqhG family protein -
  NSQ42_RS12445 (NSQ42_12445) sinI 2415772..2415945 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  NSQ42_RS12450 (NSQ42_12450) sinR 2415979..2416314 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NSQ42_RS12455 (NSQ42_12455) tasA 2416407..2417192 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  NSQ42_RS12460 (NSQ42_12460) - 2417256..2417828 (-) 573 WP_003246088.1 signal peptidase I -
  NSQ42_RS12465 (NSQ42_12465) tapA 2417812..2418573 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  NSQ42_RS12470 (NSQ42_12470) - 2418843..2419169 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  NSQ42_RS12475 (NSQ42_12475) - 2419211..2419390 (-) 180 WP_029726723.1 YqzE family protein -
  NSQ42_RS12480 (NSQ42_12480) comGG 2419462..2419836 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  NSQ42_RS12485 (NSQ42_12485) comGF 2419837..2420220 (-) 384 WP_195727813.1 competence type IV pilus minor pilin ComGF Machinery gene
  NSQ42_RS12490 (NSQ42_12490) comGE 2420246..2420593 (-) 348 WP_015714254.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=965362 NSQ42_RS12445 WP_003230187.1 2415772..2415945(+) (sinI) [Bacillus sp. FSL W8-0812]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=965362 NSQ42_RS12445 WP_003230187.1 2415772..2415945(+) (sinI) [Bacillus sp. FSL W8-0812]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment