Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   NSQ42_RS12485 Genome accession   NZ_CP150184
Coordinates   2419837..2420220 (-) Length   127 a.a.
NCBI ID   WP_195727813.1    Uniprot ID   -
Organism   Bacillus sp. FSL W8-0812     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2414837..2425220
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NSQ42_RS12445 (NSQ42_12445) sinI 2415772..2415945 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  NSQ42_RS12450 (NSQ42_12450) sinR 2415979..2416314 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NSQ42_RS12455 (NSQ42_12455) tasA 2416407..2417192 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  NSQ42_RS12460 (NSQ42_12460) - 2417256..2417828 (-) 573 WP_003246088.1 signal peptidase I -
  NSQ42_RS12465 (NSQ42_12465) tapA 2417812..2418573 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  NSQ42_RS12470 (NSQ42_12470) - 2418843..2419169 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  NSQ42_RS12475 (NSQ42_12475) - 2419211..2419390 (-) 180 WP_029726723.1 YqzE family protein -
  NSQ42_RS12480 (NSQ42_12480) comGG 2419462..2419836 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  NSQ42_RS12485 (NSQ42_12485) comGF 2419837..2420220 (-) 384 WP_195727813.1 competence type IV pilus minor pilin ComGF Machinery gene
  NSQ42_RS12490 (NSQ42_12490) comGE 2420246..2420593 (-) 348 WP_015714254.1 ComG operon protein 5 Machinery gene
  NSQ42_RS12495 (NSQ42_12495) comGD 2420577..2421008 (-) 432 WP_015714255.1 comG operon protein ComGD Machinery gene
  NSQ42_RS12500 (NSQ42_12500) comGC 2420998..2421294 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  NSQ42_RS12505 (NSQ42_12505) comGB 2421308..2422345 (-) 1038 WP_015714257.1 comG operon protein ComGB Machinery gene
  NSQ42_RS12510 (NSQ42_12510) comGA 2422332..2423402 (-) 1071 WP_015714258.1 competence protein ComGA Machinery gene
  NSQ42_RS12515 (NSQ42_12515) - 2423614..2423811 (-) 198 WP_014480259.1 CBS domain-containing protein -
  NSQ42_RS12520 (NSQ42_12520) corA 2423813..2424766 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14448.54 Da        Isoelectric Point: 6.2135

>NTDB_id=965365 NSQ42_RS12485 WP_195727813.1 2419837..2420220(-) (comGF) [Bacillus sp. FSL W8-0812]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSRQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADFENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=965365 NSQ42_RS12485 WP_195727813.1 2419837..2420220(-) (comGF) [Bacillus sp. FSL W8-0812]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCAGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

97.638

100

0.976


Multiple sequence alignment