Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   NSU05_RS12320 Genome accession   NZ_CP150177
Coordinates   2422586..2422759 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus sp. EU52     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2417586..2427759
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NSU05_RS12305 (NSU05_12305) gcvT 2418385..2419473 (-) 1089 WP_015714248.1 glycine cleavage system aminomethyltransferase GcvT -
  NSU05_RS12310 (NSU05_12310) - 2419915..2421588 (+) 1674 WP_003230203.1 SNF2-related protein -
  NSU05_RS12315 (NSU05_12315) - 2421609..2422403 (+) 795 WP_003230200.1 YqhG family protein -
  NSU05_RS12320 (NSU05_12320) sinI 2422586..2422759 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  NSU05_RS12325 (NSU05_12325) sinR 2422793..2423128 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NSU05_RS12330 (NSU05_12330) tasA 2423221..2424006 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  NSU05_RS12335 (NSU05_12335) - 2424070..2424642 (-) 573 WP_003230181.1 signal peptidase I -
  NSU05_RS12340 (NSU05_12340) tapA 2424626..2425387 (-) 762 WP_015714251.1 amyloid fiber anchoring/assembly protein TapA -
  NSU05_RS12345 (NSU05_12345) - 2425659..2425985 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  NSU05_RS12350 (NSU05_12350) - 2426027..2426206 (-) 180 WP_014480252.1 YqzE family protein -
  NSU05_RS12355 (NSU05_12355) comGG 2426277..2426651 (-) 375 WP_015714252.1 ComG operon protein ComGG Machinery gene
  NSU05_RS12360 (NSU05_12360) comGF 2426652..2427035 (-) 384 WP_038429292.1 ComG operon protein ComGF Machinery gene
  NSU05_RS12365 (NSU05_12365) comGE 2427061..2427408 (-) 348 WP_015714254.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=965084 NSU05_RS12320 WP_003230187.1 2422586..2422759(+) (sinI) [Bacillus sp. EU52]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=965084 NSU05_RS12320 WP_003230187.1 2422586..2422759(+) (sinI) [Bacillus sp. EU52]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment