Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NSS75_RS17095 Genome accession   NZ_CP150175
Coordinates   3278623..3278763 (-) Length   46 a.a.
NCBI ID   WP_024122683.1    Uniprot ID   A0A9Q4HP57
Organism   Bacillus sp. FSL K6-1012     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3273623..3283763
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NSS75_RS17070 (NSS75_17070) - 3273966..3274346 (-) 381 WP_024122679.1 hotdog fold thioesterase -
  NSS75_RS17075 (NSS75_17075) comA 3274364..3275008 (-) 645 WP_024122680.1 two-component system response regulator ComA Regulator
  NSS75_RS17080 (NSS75_17080) comP 3275089..3277389 (-) 2301 WP_339234063.1 histidine kinase Regulator
  NSS75_RS17085 (NSS75_17085) comX 3277401..3277565 (-) 165 WP_105991648.1 competence pheromone ComX -
  NSS75_RS17090 (NSS75_17090) - 3277578..3278438 (-) 861 WP_101860066.1 polyprenyl synthetase family protein -
  NSS75_RS17095 (NSS75_17095) degQ 3278623..3278763 (-) 141 WP_024122683.1 degradation enzyme regulation protein DegQ Regulator
  NSS75_RS17100 (NSS75_17100) - 3279224..3279592 (+) 369 WP_024122684.1 hypothetical protein -
  NSS75_RS17105 (NSS75_17105) - 3279568..3280797 (-) 1230 WP_044158949.1 EAL and HDOD domain-containing protein -
  NSS75_RS17110 (NSS75_17110) - 3280933..3282402 (-) 1470 WP_024122686.1 nicotinate phosphoribosyltransferase -
  NSS75_RS17115 (NSS75_17115) - 3282418..3282969 (-) 552 WP_106019480.1 isochorismatase family cysteine hydrolase -
  NSS75_RS17120 (NSS75_17120) - 3283066..3283464 (-) 399 WP_095713979.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5533.44 Da        Isoelectric Point: 6.2559

>NTDB_id=964947 NSS75_RS17095 WP_024122683.1 3278623..3278763(-) (degQ) [Bacillus sp. FSL K6-1012]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYTYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=964947 NSS75_RS17095 WP_024122683.1 3278623..3278763(-) (degQ) [Bacillus sp. FSL K6-1012]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATACACATATGCAATGAAAATTTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

97.826

100

0.978

Multiple sequence alignment