Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   NSS75_RS13175 Genome accession   NZ_CP150175
Coordinates   2557584..2557931 (-) Length   115 a.a.
NCBI ID   WP_339233339.1    Uniprot ID   -
Organism   Bacillus sp. FSL K6-1012     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2552584..2562931
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NSS75_RS13130 (NSS75_13130) sinI 2553110..2553283 (+) 174 WP_024122036.1 anti-repressor SinI family protein Regulator
  NSS75_RS13135 (NSS75_13135) sinR 2553317..2553652 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NSS75_RS13140 (NSS75_13140) tasA 2553739..2554524 (-) 786 WP_024122037.1 biofilm matrix protein TasA -
  NSS75_RS13145 (NSS75_13145) - 2554589..2555173 (-) 585 WP_268496720.1 signal peptidase I -
  NSS75_RS13150 (NSS75_13150) tapA 2555145..2555906 (-) 762 WP_101861034.1 amyloid fiber anchoring/assembly protein TapA -
  NSS75_RS13155 (NSS75_13155) - 2556183..2556506 (+) 324 WP_024122040.1 YqzG/YhdC family protein -
  NSS75_RS13160 (NSS75_13160) - 2556549..2556728 (-) 180 WP_101861035.1 YqzE family protein -
  NSS75_RS13165 (NSS75_13165) comGG 2556800..2557174 (-) 375 WP_059335411.1 competence type IV pilus minor pilin ComGG Machinery gene
  NSS75_RS13170 (NSS75_13170) comGF 2557175..2557558 (-) 384 WP_038954226.1 competence type IV pilus minor pilin ComGF Machinery gene
  NSS75_RS13175 (NSS75_13175) comGE 2557584..2557931 (-) 348 WP_339233339.1 competence type IV pilus minor pilin ComGE Machinery gene
  NSS75_RS13180 (NSS75_13180) comGD 2557915..2558346 (-) 432 WP_024122044.1 competence type IV pilus minor pilin ComGD Machinery gene
  NSS75_RS13185 (NSS75_13185) comGC 2558336..2558632 (-) 297 WP_010334925.1 competence type IV pilus major pilin ComGC Machinery gene
  NSS75_RS13190 (NSS75_13190) comGB 2558646..2559683 (-) 1038 WP_101861038.1 competence type IV pilus assembly protein ComGB Machinery gene
  NSS75_RS13195 (NSS75_13195) comGA 2559670..2560740 (-) 1071 WP_024122047.1 competence protein ComGA Machinery gene
  NSS75_RS13200 (NSS75_13200) - 2561062..2561472 (-) 411 WP_024122048.1 CBS domain-containing protein -
  NSS75_RS13205 (NSS75_13205) - 2561535..2562488 (-) 954 WP_185848826.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 115 a.a.        Molecular weight: 13276.22 Da        Isoelectric Point: 5.1182

>NTDB_id=964926 NSS75_RS13175 WP_339233339.1 2557584..2557931(-) (comGE) [Bacillus sp. FSL K6-1012]
MWRENKGFSTIETMAALSIWLFMLLTIVPLWNKLIADEHIAESREMGYQLVNESIGKYILTGKGNSSQTVSMNNSKYSMT
WEEEGKYQNVCITSDAYKDKPFCLSILRTDWLYAS

Nucleotide


Download         Length: 348 bp        

>NTDB_id=964926 NSS75_RS13175 WP_339233339.1 2557584..2557931(-) (comGE) [Bacillus sp. FSL K6-1012]
ATGTGGAGAGAAAATAAAGGCTTTTCTACAATTGAAACAATGGCTGCCCTCAGCATATGGCTCTTTATGCTTCTGACGAT
CGTGCCGTTGTGGAACAAGCTGATAGCTGATGAACATATAGCGGAGTCGAGAGAAATGGGTTATCAGCTTGTCAATGAAA
GCATAGGCAAATATATACTGACAGGAAAAGGAAATTCGTCACAAACTGTTTCGATGAACAATAGCAAATACTCGATGACA
TGGGAGGAGGAGGGAAAGTATCAAAACGTATGCATCACATCAGACGCCTATAAAGACAAGCCATTTTGCCTCAGCATTTT
GCGGACAGACTGGCTATACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

69.565

100

0.696

Multiple sequence alignment