Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NSQ53_RS17375 Genome accession   NZ_CP150164
Coordinates   3279291..3279431 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus sp. PS11(2022) isolate PS11     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3274291..3284431
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NSQ53_RS17350 (NSQ53_17350) - 3274604..3274984 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  NSQ53_RS17355 (NSQ53_17355) comA 3275003..3275647 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  NSQ53_RS17360 (NSQ53_17360) comP 3275728..3278037 (-) 2310 WP_213391296.1 histidine kinase Regulator
  NSQ53_RS17365 (NSQ53_17365) comX 3278052..3278219 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  NSQ53_RS17370 (NSQ53_17370) comQ 3278207..3279106 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  NSQ53_RS17375 (NSQ53_17375) degQ 3279291..3279431 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  NSQ53_RS17380 (NSQ53_17380) - 3279653..3279778 (+) 126 WP_003228793.1 hypothetical protein -
  NSQ53_RS17385 (NSQ53_17385) - 3279892..3280260 (+) 369 WP_003243784.1 hypothetical protein -
  NSQ53_RS17390 (NSQ53_17390) pdeH 3280236..3281465 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  NSQ53_RS17395 (NSQ53_17395) - 3281602..3283074 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  NSQ53_RS17400 (NSQ53_17400) - 3283090..3283641 (-) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  NSQ53_RS17405 (NSQ53_17405) - 3283738..3284136 (-) 399 WP_003242987.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=964431 NSQ53_RS17375 WP_003220708.1 3279291..3279431(-) (degQ) [Bacillus sp. PS11(2022) isolate PS11]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=964431 NSQ53_RS17375 WP_003220708.1 3279291..3279431(-) (degQ) [Bacillus sp. PS11(2022) isolate PS11]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment