Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   NSQ53_RS17365 Genome accession   NZ_CP150164
Coordinates   3278052..3278219 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus sp. PS11(2022) isolate PS11     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3273052..3283219
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NSQ53_RS17335 (NSQ53_17335) - 3273447..3273923 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  NSQ53_RS17340 (NSQ53_17340) - 3273923..3274207 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  NSQ53_RS17345 (NSQ53_17345) mnhG 3274191..3274565 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  NSQ53_RS17350 (NSQ53_17350) - 3274604..3274984 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  NSQ53_RS17355 (NSQ53_17355) comA 3275003..3275647 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  NSQ53_RS17360 (NSQ53_17360) comP 3275728..3278037 (-) 2310 WP_213391296.1 histidine kinase Regulator
  NSQ53_RS17365 (NSQ53_17365) comX 3278052..3278219 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  NSQ53_RS17370 (NSQ53_17370) comQ 3278207..3279106 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  NSQ53_RS17375 (NSQ53_17375) degQ 3279291..3279431 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  NSQ53_RS17380 (NSQ53_17380) - 3279653..3279778 (+) 126 WP_003228793.1 hypothetical protein -
  NSQ53_RS17385 (NSQ53_17385) - 3279892..3280260 (+) 369 WP_003243784.1 hypothetical protein -
  NSQ53_RS17390 (NSQ53_17390) pdeH 3280236..3281465 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  NSQ53_RS17395 (NSQ53_17395) - 3281602..3283074 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=964429 NSQ53_RS17365 WP_003242801.1 3278052..3278219(-) (comX) [Bacillus sp. PS11(2022) isolate PS11]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=964429 NSQ53_RS17365 WP_003242801.1 3278052..3278219(-) (comX) [Bacillus sp. PS11(2022) isolate PS11]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment