Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   NSQ53_RS13500 Genome accession   NZ_CP150164
Coordinates   2574646..2574819 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus sp. PS11(2022) isolate PS11     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2569646..2579819
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NSQ53_RS13485 (NSQ53_13485) gcvT 2570445..2571533 (-) 1089 WP_003230205.1 glycine cleavage system aminomethyltransferase GcvT -
  NSQ53_RS13490 (NSQ53_13490) - 2571975..2573648 (+) 1674 WP_003230203.1 SNF2-related protein -
  NSQ53_RS13495 (NSQ53_13495) - 2573669..2574463 (+) 795 WP_003230200.1 YqhG family protein -
  NSQ53_RS13500 (NSQ53_13500) sinI 2574646..2574819 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  NSQ53_RS13505 (NSQ53_13505) sinR 2574853..2575188 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NSQ53_RS13510 (NSQ53_13510) tasA 2575281..2576066 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  NSQ53_RS13515 (NSQ53_13515) - 2576130..2576702 (-) 573 WP_003230181.1 signal peptidase I -
  NSQ53_RS13520 (NSQ53_13520) tapA 2576686..2577447 (-) 762 WP_003230180.1 amyloid fiber anchoring/assembly protein TapA -
  NSQ53_RS13525 (NSQ53_13525) - 2577719..2578045 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  NSQ53_RS13530 (NSQ53_13530) - 2578087..2578266 (-) 180 WP_003230176.1 YqzE family protein -
  NSQ53_RS13535 (NSQ53_13535) comGG 2578337..2578711 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  NSQ53_RS13540 (NSQ53_13540) comGF 2578712..2579095 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  NSQ53_RS13545 (NSQ53_13545) comGE 2579121..2579468 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=964405 NSQ53_RS13500 WP_003230187.1 2574646..2574819(+) (sinI) [Bacillus sp. PS11(2022) isolate PS11]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=964405 NSQ53_RS13500 WP_003230187.1 2574646..2574819(+) (sinI) [Bacillus sp. PS11(2022) isolate PS11]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment