Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   NSQ53_RS13540 Genome accession   NZ_CP150164
Coordinates   2578712..2579095 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   -
Organism   Bacillus sp. PS11(2022) isolate PS11     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2573712..2584095
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NSQ53_RS13500 (NSQ53_13500) sinI 2574646..2574819 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  NSQ53_RS13505 (NSQ53_13505) sinR 2574853..2575188 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NSQ53_RS13510 (NSQ53_13510) tasA 2575281..2576066 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  NSQ53_RS13515 (NSQ53_13515) - 2576130..2576702 (-) 573 WP_003230181.1 signal peptidase I -
  NSQ53_RS13520 (NSQ53_13520) tapA 2576686..2577447 (-) 762 WP_003230180.1 amyloid fiber anchoring/assembly protein TapA -
  NSQ53_RS13525 (NSQ53_13525) - 2577719..2578045 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  NSQ53_RS13530 (NSQ53_13530) - 2578087..2578266 (-) 180 WP_003230176.1 YqzE family protein -
  NSQ53_RS13535 (NSQ53_13535) comGG 2578337..2578711 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  NSQ53_RS13540 (NSQ53_13540) comGF 2578712..2579095 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  NSQ53_RS13545 (NSQ53_13545) comGE 2579121..2579468 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  NSQ53_RS13550 (NSQ53_13550) comGD 2579452..2579883 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  NSQ53_RS13555 (NSQ53_13555) comGC 2579873..2580169 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  NSQ53_RS13560 (NSQ53_13560) comGB 2580183..2581220 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  NSQ53_RS13565 (NSQ53_13565) comGA 2581207..2582277 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  NSQ53_RS13570 (NSQ53_13570) corA 2582689..2583642 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=964408 NSQ53_RS13540 WP_003230168.1 2578712..2579095(-) (comGF) [Bacillus sp. PS11(2022) isolate PS11]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=964408 NSQ53_RS13540 WP_003230168.1 2578712..2579095(-) (comGF) [Bacillus sp. PS11(2022) isolate PS11]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment