Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   NSQ81_RS12490 Genome accession   NZ_CP150163
Coordinates   2441333..2441506 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus sp. PS65     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2436333..2446506
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NSQ81_RS12475 (NSQ81_12475) gcvT 2437132..2438220 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  NSQ81_RS12480 (NSQ81_12480) - 2438662..2440335 (+) 1674 WP_004398544.1 SNF2-related protein -
  NSQ81_RS12485 (NSQ81_12485) - 2440356..2441150 (+) 795 WP_003230200.1 YqhG family protein -
  NSQ81_RS12490 (NSQ81_12490) sinI 2441333..2441506 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  NSQ81_RS12495 (NSQ81_12495) sinR 2441540..2441875 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NSQ81_RS12500 (NSQ81_12500) tasA 2441968..2442753 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  NSQ81_RS12505 (NSQ81_12505) - 2442817..2443389 (-) 573 WP_003246088.1 signal peptidase I -
  NSQ81_RS12510 (NSQ81_12510) tapA 2443373..2444134 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  NSQ81_RS12515 (NSQ81_12515) - 2444406..2444732 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  NSQ81_RS12520 (NSQ81_12520) - 2444774..2444953 (-) 180 WP_003230176.1 YqzE family protein -
  NSQ81_RS12525 (NSQ81_12525) comGG 2445024..2445398 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  NSQ81_RS12530 (NSQ81_12530) comGF 2445399..2445782 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  NSQ81_RS12535 (NSQ81_12535) comGE 2445808..2446155 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=964319 NSQ81_RS12490 WP_003230187.1 2441333..2441506(+) (sinI) [Bacillus sp. PS65]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=964319 NSQ81_RS12490 WP_003230187.1 2441333..2441506(+) (sinI) [Bacillus sp. PS65]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment