Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   NST79_RS12850 Genome accession   NZ_CP150159
Coordinates   2480120..2480503 (-) Length   127 a.a.
NCBI ID   WP_080529536.1    Uniprot ID   -
Organism   Bacillus sp. PS196     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2475120..2485503
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NST79_RS12810 (NST79_12810) sinI 2476053..2476226 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  NST79_RS12815 (NST79_12815) sinR 2476260..2476595 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NST79_RS12820 (NST79_12820) tasA 2476688..2477473 (-) 786 WP_212058891.1 TasA family protein -
  NST79_RS12825 (NST79_12825) - 2477537..2478109 (-) 573 WP_192858455.1 signal peptidase I -
  NST79_RS12830 (NST79_12830) tapA 2478093..2478854 (-) 762 WP_212058893.1 amyloid fiber anchoring/assembly protein TapA -
  NST79_RS12835 (NST79_12835) - 2479126..2479452 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  NST79_RS12840 (NST79_12840) - 2479494..2479673 (-) 180 WP_029726723.1 YqzE family protein -
  NST79_RS12845 (NST79_12845) comGG 2479745..2480119 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  NST79_RS12850 (NST79_12850) comGF 2480120..2480503 (-) 384 WP_080529536.1 ComG operon protein ComGF Machinery gene
  NST79_RS12855 (NST79_12855) comGE 2480529..2480876 (-) 348 WP_080529537.1 ComG operon protein 5 Machinery gene
  NST79_RS12860 (NST79_12860) comGD 2480860..2481291 (-) 432 WP_212058895.1 competence type IV pilus minor pilin ComGD Machinery gene
  NST79_RS12865 (NST79_12865) comGC 2481281..2481577 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  NST79_RS12870 (NST79_12870) comGB 2481591..2482628 (-) 1038 WP_212058897.1 comG operon protein ComGB Machinery gene
  NST79_RS12875 (NST79_12875) comGA 2482615..2483685 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  NST79_RS12880 (NST79_12880) - 2483897..2484094 (-) 198 WP_014480259.1 CBS domain-containing protein -
  NST79_RS12885 (NST79_12885) corA 2484096..2485049 (-) 954 WP_015483432.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14414.53 Da        Isoelectric Point: 6.2135

>NTDB_id=963992 NST79_RS12850 WP_080529536.1 2480120..2480503(-) (comGF) [Bacillus sp. PS196]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGR

Nucleotide


Download         Length: 384 bp        

>NTDB_id=963992 NST79_RS12850 WP_080529536.1 2480120..2480503(-) (comGF) [Bacillus sp. PS196]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGAGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

99.206

99.213

0.984