Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   NST79_RS12810 Genome accession   NZ_CP150159
Coordinates   2476053..2476226 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus sp. PS196     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2471053..2481226
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NST79_RS12795 (NST79_12795) gcvT 2471853..2472941 (-) 1089 WP_212058882.1 glycine cleavage system aminomethyltransferase GcvT -
  NST79_RS12800 (NST79_12800) - 2473382..2475055 (+) 1674 WP_085186487.1 SNF2-related protein -
  NST79_RS12805 (NST79_12805) - 2475076..2475870 (+) 795 WP_003230200.1 YqhG family protein -
  NST79_RS12810 (NST79_12810) sinI 2476053..2476226 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  NST79_RS12815 (NST79_12815) sinR 2476260..2476595 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NST79_RS12820 (NST79_12820) tasA 2476688..2477473 (-) 786 WP_212058891.1 TasA family protein -
  NST79_RS12825 (NST79_12825) - 2477537..2478109 (-) 573 WP_192858455.1 signal peptidase I -
  NST79_RS12830 (NST79_12830) tapA 2478093..2478854 (-) 762 WP_212058893.1 amyloid fiber anchoring/assembly protein TapA -
  NST79_RS12835 (NST79_12835) - 2479126..2479452 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  NST79_RS12840 (NST79_12840) - 2479494..2479673 (-) 180 WP_029726723.1 YqzE family protein -
  NST79_RS12845 (NST79_12845) comGG 2479745..2480119 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  NST79_RS12850 (NST79_12850) comGF 2480120..2480503 (-) 384 WP_080529536.1 ComG operon protein ComGF Machinery gene
  NST79_RS12855 (NST79_12855) comGE 2480529..2480876 (-) 348 WP_080529537.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=963989 NST79_RS12810 WP_003230187.1 2476053..2476226(+) (sinI) [Bacillus sp. PS196]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=963989 NST79_RS12810 WP_003230187.1 2476053..2476226(+) (sinI) [Bacillus sp. PS196]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1