Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   NSQ83_RS12495 Genome accession   NZ_CP150157
Coordinates   2436297..2436680 (-) Length   127 a.a.
NCBI ID   WP_032726158.1    Uniprot ID   A0AAX3RJE0
Organism   Bacillus sp. PS217     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2431297..2441680
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NSQ83_RS12455 (NSQ83_12455) sinI 2432231..2432404 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  NSQ83_RS12460 (NSQ83_12460) sinR 2432438..2432773 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NSQ83_RS12465 (NSQ83_12465) tasA 2432866..2433651 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  NSQ83_RS12470 (NSQ83_12470) - 2433715..2434287 (-) 573 WP_072692741.1 signal peptidase I -
  NSQ83_RS12475 (NSQ83_12475) tapA 2434271..2435032 (-) 762 WP_198878634.1 amyloid fiber anchoring/assembly protein TapA -
  NSQ83_RS12480 (NSQ83_12480) - 2435304..2435630 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  NSQ83_RS12485 (NSQ83_12485) - 2435672..2435851 (-) 180 WP_072175549.1 YqzE family protein -
  NSQ83_RS12490 (NSQ83_12490) comGG 2435922..2436296 (-) 375 WP_133953114.1 ComG operon protein ComGG Machinery gene
  NSQ83_RS12495 (NSQ83_12495) comGF 2436297..2436680 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  NSQ83_RS12500 (NSQ83_12500) comGE 2436706..2437053 (-) 348 WP_080529537.1 ComG operon protein 5 Machinery gene
  NSQ83_RS12505 (NSQ83_12505) comGD 2437037..2437468 (-) 432 WP_080529538.1 comG operon protein ComGD Machinery gene
  NSQ83_RS12510 (NSQ83_12510) comGC 2437458..2437754 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  NSQ83_RS12515 (NSQ83_12515) comGB 2437768..2438805 (-) 1038 WP_044052501.1 comG operon protein ComGB Machinery gene
  NSQ83_RS12520 (NSQ83_12520) comGA 2438792..2439862 (-) 1071 WP_129134318.1 competence protein ComGA Machinery gene
  NSQ83_RS12525 (NSQ83_12525) - 2440074..2440271 (-) 198 WP_129134319.1 hypothetical protein -
  NSQ83_RS12530 (NSQ83_12530) corA 2440273..2441226 (-) 954 WP_198878633.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14315.39 Da        Isoelectric Point: 5.8929

>NTDB_id=963830 NSQ83_RS12495 WP_032726158.1 2436297..2436680(-) (comGF) [Bacillus sp. PS217]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=963830 NSQ83_RS12495 WP_032726158.1 2436297..2436680(-) (comGF) [Bacillus sp. PS217]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCTATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

99.213

100

0.992