Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   NSQ83_RS12455 Genome accession   NZ_CP150157
Coordinates   2432231..2432404 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus sp. PS217     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2427231..2437404
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NSQ83_RS12440 (NSQ83_12440) gcvT 2428030..2429118 (-) 1089 WP_015714248.1 glycine cleavage system aminomethyltransferase GcvT -
  NSQ83_RS12445 (NSQ83_12445) - 2429560..2431233 (+) 1674 WP_198878635.1 SNF2-related protein -
  NSQ83_RS12450 (NSQ83_12450) - 2431254..2432048 (+) 795 WP_003230200.1 YqhG family protein -
  NSQ83_RS12455 (NSQ83_12455) sinI 2432231..2432404 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  NSQ83_RS12460 (NSQ83_12460) sinR 2432438..2432773 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NSQ83_RS12465 (NSQ83_12465) tasA 2432866..2433651 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  NSQ83_RS12470 (NSQ83_12470) - 2433715..2434287 (-) 573 WP_072692741.1 signal peptidase I -
  NSQ83_RS12475 (NSQ83_12475) tapA 2434271..2435032 (-) 762 WP_198878634.1 amyloid fiber anchoring/assembly protein TapA -
  NSQ83_RS12480 (NSQ83_12480) - 2435304..2435630 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  NSQ83_RS12485 (NSQ83_12485) - 2435672..2435851 (-) 180 WP_072175549.1 YqzE family protein -
  NSQ83_RS12490 (NSQ83_12490) comGG 2435922..2436296 (-) 375 WP_133953114.1 ComG operon protein ComGG Machinery gene
  NSQ83_RS12495 (NSQ83_12495) comGF 2436297..2436680 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  NSQ83_RS12500 (NSQ83_12500) comGE 2436706..2437053 (-) 348 WP_080529537.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=963827 NSQ83_RS12455 WP_003230187.1 2432231..2432404(+) (sinI) [Bacillus sp. PS217]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=963827 NSQ83_RS12455 WP_003230187.1 2432231..2432404(+) (sinI) [Bacillus sp. PS217]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1