Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   WKI52_RS17465 Genome accession   NZ_CP149646
Coordinates   3518009..3518386 (-) Length   125 a.a.
NCBI ID   WP_017418138.1    Uniprot ID   -
Organism   Bacillus velezensis strain MJ06     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 3513009..3523386
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WKI52_RS17425 (WKI52_17425) - 3513506..3514300 (+) 795 WP_014418368.1 YqhG family protein -
  WKI52_RS17430 (WKI52_17430) sinI 3514477..3514650 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  WKI52_RS17435 (WKI52_17435) sinR 3514684..3515019 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  WKI52_RS17440 (WKI52_17440) - 3515067..3515852 (-) 786 WP_017418136.1 TasA family protein -
  WKI52_RS17445 (WKI52_17445) - 3515917..3516501 (-) 585 WP_014418370.1 signal peptidase I -
  WKI52_RS17450 (WKI52_17450) tapA 3516473..3517144 (-) 672 WP_025649852.1 amyloid fiber anchoring/assembly protein TapA -
  WKI52_RS17455 (WKI52_17455) - 3517403..3517732 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  WKI52_RS17460 (WKI52_17460) - 3517773..3517952 (-) 180 WP_003153093.1 YqzE family protein -
  WKI52_RS17465 (WKI52_17465) comGG 3518009..3518386 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  WKI52_RS17470 (WKI52_17470) comGF 3518387..3518782 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  WKI52_RS17475 (WKI52_17475) comGE 3518796..3519110 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  WKI52_RS17480 (WKI52_17480) comGD 3519094..3519531 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  WKI52_RS17485 (WKI52_17485) comGC 3519521..3519829 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  WKI52_RS17490 (WKI52_17490) comGB 3519834..3520871 (-) 1038 WP_053284924.1 competence type IV pilus assembly protein ComGB Machinery gene
  WKI52_RS17495 (WKI52_17495) comGA 3520858..3521928 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  WKI52_RS17500 (WKI52_17500) - 3522121..3523071 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14125.01 Da        Isoelectric Point: 9.7165

>NTDB_id=960230 WKI52_RS17465 WP_017418138.1 3518009..3518386(-) (comGG) [Bacillus velezensis strain MJ06]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKGQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=960230 WKI52_RS17465 WP_017418138.1 3518009..3518386(-) (comGG) [Bacillus velezensis strain MJ06]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGGCCAAACTGGTACACAGCGTTTTCCGTACGGCACCGTTTCT
TTTCACATCACCGGGAGTGATCGAAGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512