Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   WKI52_RS17430 Genome accession   NZ_CP149646
Coordinates   3514477..3514650 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain MJ06     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 3509477..3519650
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WKI52_RS17415 (WKI52_17415) gcvT 3510290..3511390 (-) 1101 WP_017418134.1 glycine cleavage system aminomethyltransferase GcvT -
  WKI52_RS17420 (WKI52_17420) - 3511814..3513484 (+) 1671 WP_021494309.1 SNF2-related protein -
  WKI52_RS17425 (WKI52_17425) - 3513506..3514300 (+) 795 WP_014418368.1 YqhG family protein -
  WKI52_RS17430 (WKI52_17430) sinI 3514477..3514650 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  WKI52_RS17435 (WKI52_17435) sinR 3514684..3515019 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  WKI52_RS17440 (WKI52_17440) - 3515067..3515852 (-) 786 WP_017418136.1 TasA family protein -
  WKI52_RS17445 (WKI52_17445) - 3515917..3516501 (-) 585 WP_014418370.1 signal peptidase I -
  WKI52_RS17450 (WKI52_17450) tapA 3516473..3517144 (-) 672 WP_025649852.1 amyloid fiber anchoring/assembly protein TapA -
  WKI52_RS17455 (WKI52_17455) - 3517403..3517732 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  WKI52_RS17460 (WKI52_17460) - 3517773..3517952 (-) 180 WP_003153093.1 YqzE family protein -
  WKI52_RS17465 (WKI52_17465) comGG 3518009..3518386 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  WKI52_RS17470 (WKI52_17470) comGF 3518387..3518782 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  WKI52_RS17475 (WKI52_17475) comGE 3518796..3519110 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  WKI52_RS17480 (WKI52_17480) comGD 3519094..3519531 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=960228 WKI52_RS17430 WP_014418369.1 3514477..3514650(+) (sinI) [Bacillus velezensis strain MJ06]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=960228 WKI52_RS17430 WP_014418369.1 3514477..3514650(+) (sinI) [Bacillus velezensis strain MJ06]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719