Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   WKI52_RS00465 Genome accession   NZ_CP149646
Coordinates   83594..83734 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain MJ06     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 78594..88734
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WKI52_RS00440 (WKI52_00440) - 78891..79274 (-) 384 WP_339073161.1 hotdog fold thioesterase -
  WKI52_RS00445 (WKI52_00445) comA 79296..79940 (-) 645 WP_014418762.1 response regulator transcription factor Regulator
  WKI52_RS00450 (WKI52_00450) comP 80021..82324 (-) 2304 WP_101562386.1 histidine kinase Regulator
  WKI52_RS00455 (WKI52_00455) comX 82344..82523 (-) 180 WP_318010531.1 competence pheromone ComX -
  WKI52_RS00460 (WKI52_00460) comQ 82477..83463 (-) 987 WP_339073162.1 class 1 isoprenoid biosynthesis enzyme Regulator
  WKI52_RS00465 (WKI52_00465) degQ 83594..83734 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  WKI52_RS00470 (WKI52_00470) - 84199..84540 (+) 342 WP_021495366.1 hypothetical protein -
  WKI52_RS00475 (WKI52_00475) - 84547..85770 (-) 1224 WP_014418766.1 EAL and HDOD domain-containing protein -
  WKI52_RS00480 (WKI52_00480) - 85900..87366 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  WKI52_RS00485 (WKI52_00485) - 87384..87935 (-) 552 WP_017419426.1 isochorismatase family cysteine hydrolase -
  WKI52_RS00490 (WKI52_00490) - 88032..88430 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=960176 WKI52_RS00465 WP_003152043.1 83594..83734(-) (degQ) [Bacillus velezensis strain MJ06]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=960176 WKI52_RS00465 WP_003152043.1 83594..83734(-) (degQ) [Bacillus velezensis strain MJ06]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891