Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   WHL52_RS13390 Genome accession   NZ_CP149576
Coordinates   2551732..2552115 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   -
Organism   Bacillus subtilis strain DSM 10     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2546732..2557115
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WHL52_RS13350 sinI 2547666..2547839 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  WHL52_RS13355 sinR 2547873..2548208 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  WHL52_RS13360 tasA 2548301..2549086 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  WHL52_RS13365 sipW 2549150..2549722 (-) 573 WP_003246088.1 signal peptidase I -
  WHL52_RS13370 tapA 2549706..2550467 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  WHL52_RS13375 yqzG 2550739..2551065 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  WHL52_RS13380 spoIIT 2551107..2551286 (-) 180 WP_003230176.1 YqzE family protein -
  WHL52_RS13385 comGG 2551357..2551731 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  WHL52_RS13390 comGF 2551732..2552115 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  WHL52_RS13395 comGE 2552141..2552488 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  WHL52_RS13400 comGD 2552472..2552903 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  WHL52_RS13405 comGC 2552893..2553189 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  WHL52_RS13410 comGB 2553203..2554240 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  WHL52_RS13415 comGA 2554227..2555297 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  WHL52_RS13420 corA 2555709..2556662 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=959973 WHL52_RS13390 WP_003230168.1 2551732..2552115(-) (comGF) [Bacillus subtilis strain DSM 10]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=959973 WHL52_RS13390 WP_003230168.1 2551732..2552115(-) (comGF) [Bacillus subtilis strain DSM 10]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1