Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | WJ050_RS11890 | Genome accession | NZ_CP149495 |
| Coordinates | 2388414..2388896 (-) | Length | 160 a.a. |
| NCBI ID | WP_003722552.1 | Uniprot ID | A0A3T2EU60 |
| Organism | Listeria monocytogenes EGD-e | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2350083..2402920 | 2388414..2388896 | within | 0 |
Gene organization within MGE regions
Location: 2350083..2402920
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| WJ050_RS11660 (WJ050_11655) | - | 2350083..2350985 (-) | 903 | WP_003723662.1 | YitT family protein | - |
| WJ050_RS11665 (WJ050_11660) | - | 2351069..2351431 (-) | 363 | WP_009925066.1 | YisL family protein | - |
| WJ050_RS11670 (WJ050_11665) | - | 2351452..2352300 (-) | 849 | WP_009930518.1 | fumarylacetoacetate hydrolase family protein | - |
| WJ050_RS11675 (WJ050_11670) | addA | 2352301..2356008 (-) | 3708 | WP_010989936.1 | helicase-exonuclease AddAB subunit AddA | - |
| WJ050_RS11680 (WJ050_11675) | addB | 2356010..2359483 (-) | 3474 | WP_010989937.1 | helicase-exonuclease AddAB subunit AddB | - |
| WJ050_RS11685 (WJ050_11680) | - | 2359633..2359989 (-) | 357 | WP_003723667.1 | IDEAL domain-containing protein | - |
| WJ050_RS11690 (WJ050_11685) | - | 2360120..2360398 (+) | 279 | WP_010989938.1 | competence protein ComK | - |
| WJ050_RS11695 (WJ050_11690) | - | 2360399..2360596 (-) | 198 | WP_003734110.1 | hypothetical protein | - |
| WJ050_RS11700 (WJ050_11695) | - | 2360593..2360826 (-) | 234 | WP_010989939.1 | hypothetical protein | - |
| WJ050_RS11705 (WJ050_11700) | - | 2361267..2361476 (+) | 210 | WP_003727805.1 | hypothetical protein | - |
| WJ050_RS11710 (WJ050_11705) | acrIIA3 | 2361582..2361959 (+) | 378 | WP_010989940.1 | anti-CRISPR protein AcrIIA3 | - |
| WJ050_RS11715 (WJ050_11710) | - | 2361991..2362341 (+) | 351 | WP_010989941.1 | AcrIIA2 family anti-CRISPR protein | - |
| WJ050_RS11720 (WJ050_11715) | acrIIA1 | 2362346..2362795 (+) | 450 | WP_010989942.1 | anti-CRISPR protein AcrIIA1 | - |
| WJ050_RS11725 (WJ050_11720) | - | 2362820..2363317 (+) | 498 | WP_009926666.1 | AP2 domain-containing protein | - |
| WJ050_RS11730 (WJ050_11725) | - | 2363394..2363945 (-) | 552 | WP_010989943.1 | PBECR4 domain-containing protein | - |
| WJ050_RS11735 (WJ050_11730) | - | 2364439..2365284 (-) | 846 | WP_010989944.1 | DUF5776 domain-containing protein | - |
| WJ050_RS11740 (WJ050_11735) | - | 2365284..2365565 (-) | 282 | WP_010989945.1 | holin | - |
| WJ050_RS11745 (WJ050_11740) | - | 2365578..2365943 (-) | 366 | WP_003722523.1 | Gp23 family protein | - |
| WJ050_RS11750 (WJ050_11745) | - | 2365973..2366131 (-) | 159 | WP_003734113.1 | CD1375 family protein | - |
| WJ050_RS11755 (WJ050_11750) | - | 2366136..2366453 (-) | 318 | WP_003727798.1 | hypothetical protein | - |
| WJ050_RS11760 (WJ050_11755) | - | 2366465..2367538 (-) | 1074 | WP_010989946.1 | phage baseplate upper protein | - |
| WJ050_RS11765 (WJ050_11760) | - | 2367538..2368566 (-) | 1029 | WP_003722527.1 | hypothetical protein | - |
| WJ050_RS11770 (WJ050_11765) | - | 2368567..2369592 (-) | 1026 | WP_010989947.1 | phage tail protein | - |
| WJ050_RS11775 (WJ050_11770) | - | 2369601..2370419 (-) | 819 | WP_010989948.1 | phage tail family protein | - |
| WJ050_RS11780 (WJ050_11775) | - | 2370421..2375784 (-) | 5364 | WP_010989949.1 | tape measure protein | - |
| WJ050_RS11785 (WJ050_11780) | - | 2375795..2376400 (-) | 606 | WP_003722531.1 | bacteriophage Gp15 family protein | - |
| WJ050_RS11790 (WJ050_11785) | - | 2376406..2376828 (-) | 423 | WP_003727791.1 | phage tail assembly chaperone | - |
| WJ050_RS11795 (WJ050_11790) | - | 2376883..2377215 (-) | 333 | WP_003727790.1 | Ig-like domain-containing protein | - |
| WJ050_RS11800 (WJ050_11795) | - | 2377145..2377579 (-) | 435 | WP_009925981.1 | phage tail tube protein | - |
| WJ050_RS11805 (WJ050_11800) | - | 2377582..2377989 (-) | 408 | WP_003737937.1 | minor capsid protein | - |
| WJ050_RS11810 (WJ050_11805) | - | 2377989..2378327 (-) | 339 | WP_010989950.1 | minor capsid protein | - |
| WJ050_RS11815 (WJ050_11810) | - | 2378327..2378689 (-) | 363 | WP_010989951.1 | minor capsid protein | - |
| WJ050_RS11820 (WJ050_11815) | - | 2378689..2379084 (-) | 396 | WP_010989952.1 | hypothetical protein | - |
| WJ050_RS11825 (WJ050_11820) | - | 2379103..2380104 (-) | 1002 | WP_010989953.1 | major capsid protein | - |
| WJ050_RS11830 (WJ050_11825) | - | 2380104..2380694 (-) | 591 | WP_003769956.1 | phage scaffolding protein | - |
| WJ050_RS11835 (WJ050_11830) | - | 2380773..2381912 (-) | 1140 | WP_010989954.1 | phage minor capsid protein | - |
| WJ050_RS11840 (WJ050_11835) | - | 2381913..2383673 (-) | 1761 | WP_010989955.1 | phage portal protein | - |
| WJ050_RS11845 (WJ050_11840) | - | 2383686..2385017 (-) | 1332 | WP_010989956.1 | PBSX family phage terminase large subunit | - |
| WJ050_RS11850 (WJ050_11845) | - | 2384986..2385780 (-) | 795 | WP_010989957.1 | terminase small subunit | - |
| WJ050_RS11855 (WJ050_11850) | - | 2385826..2386365 (-) | 540 | WP_003734122.1 | hypothetical protein | - |
| WJ050_RS11860 (WJ050_11855) | - | 2386731..2387165 (-) | 435 | WP_003735131.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| WJ050_RS11865 (WJ050_11860) | - | 2387184..2387348 (-) | 165 | WP_003727776.1 | hypothetical protein | - |
| WJ050_RS11870 (WJ050_11865) | - | 2387359..2387484 (-) | 126 | WP_009924216.1 | hypothetical protein | - |
| WJ050_RS11875 (WJ050_11870) | - | 2387477..2387860 (-) | 384 | WP_009924217.1 | DUF2481 family protein | - |
| WJ050_RS11880 (WJ050_11875) | - | 2387864..2388268 (-) | 405 | WP_010989958.1 | DUF1064 domain-containing protein | - |
| WJ050_RS11885 (WJ050_11880) | - | 2388213..2388395 (-) | 183 | WP_009924219.1 | hypothetical protein | - |
| WJ050_RS11890 (WJ050_11885) | ssbA | 2388414..2388896 (-) | 483 | WP_003722552.1 | single-stranded DNA-binding protein | Machinery gene |
| WJ050_RS11895 (WJ050_11890) | - | 2388893..2389072 (-) | 180 | WP_003733878.1 | hypothetical protein | - |
| WJ050_RS11900 (WJ050_11895) | - | 2389176..2389343 (-) | 168 | WP_003722554.1 | hypothetical protein | - |
| WJ050_RS11905 (WJ050_11900) | - | 2389340..2389801 (-) | 462 | WP_003722555.1 | hypothetical protein | - |
| WJ050_RS11910 (WJ050_11905) | - | 2389798..2390268 (-) | 471 | WP_003722556.1 | pentapeptide repeat-containing protein | - |
| WJ050_RS11915 (WJ050_11910) | - | 2390265..2390708 (-) | 444 | WP_003722557.1 | YopX family protein | - |
| WJ050_RS11920 (WJ050_11915) | - | 2390705..2390902 (-) | 198 | WP_003722558.1 | hypothetical protein | - |
| WJ050_RS11925 (WJ050_11920) | - | 2390905..2391501 (-) | 597 | WP_003734130.1 | DUF1642 domain-containing protein | - |
| WJ050_RS11930 (WJ050_11925) | - | 2391498..2392310 (-) | 813 | WP_003722560.1 | DNA adenine methylase | - |
| WJ050_RS11935 (WJ050_11930) | - | 2392307..2393281 (-) | 975 | WP_010989959.1 | phage replisome organizer N-terminal domain-containing protein | - |
| WJ050_RS11940 (WJ050_11935) | - | 2393298..2393996 (-) | 699 | WP_010989960.1 | ERF family protein | - |
| WJ050_RS11945 (WJ050_11940) | - | 2394002..2394478 (-) | 477 | WP_010989961.1 | siphovirus Gp157 family protein | - |
| WJ050_RS11950 (WJ050_11945) | - | 2394475..2394669 (-) | 195 | WP_003734953.1 | hypothetical protein | - |
| WJ050_RS11955 (WJ050_11950) | - | 2394765..2394893 (-) | 129 | WP_256017794.1 | hypothetical protein | - |
| WJ050_RS11960 (WJ050_11955) | - | 2394975..2395163 (-) | 189 | WP_010989962.1 | gp45 family putative tail fiber system protein | - |
| WJ050_RS11965 (WJ050_11960) | - | 2395271..2395486 (-) | 216 | WP_010989963.1 | hypothetical protein | - |
| WJ050_RS11970 (WJ050_11965) | - | 2395483..2396016 (-) | 534 | WP_010989964.1 | hypothetical protein | - |
| WJ050_RS11975 (WJ050_11970) | - | 2396139..2396915 (-) | 777 | WP_003722566.1 | phage antirepressor Ant | - |
| WJ050_RS11980 (WJ050_11975) | - | 2396979..2397176 (+) | 198 | WP_003733684.1 | hypothetical protein | - |
| WJ050_RS11985 (WJ050_11980) | - | 2397178..2397459 (-) | 282 | WP_003722567.1 | hypothetical protein | - |
| WJ050_RS11990 (WJ050_11985) | - | 2397485..2397769 (-) | 285 | WP_003733686.1 | hypothetical protein | - |
| WJ050_RS11995 (WJ050_11990) | - | 2397781..2397975 (-) | 195 | WP_003733687.1 | hypothetical protein | - |
| WJ050_RS12000 (WJ050_11995) | - | 2397972..2398214 (-) | 243 | WP_003722568.1 | helix-turn-helix transcriptional regulator | - |
| WJ050_RS12005 (WJ050_12000) | - | 2398370..2398846 (+) | 477 | WP_003722569.1 | helix-turn-helix domain-containing protein | - |
| WJ050_RS12010 (WJ050_12005) | - | 2399005..2399172 (+) | 168 | WP_020975175.1 | hypothetical protein | - |
| WJ050_RS12015 (WJ050_12010) | - | 2399227..2399928 (+) | 702 | WP_003722570.1 | hypothetical protein | - |
| WJ050_RS12020 (WJ050_12015) | - | 2399949..2400629 (+) | 681 | WP_010989965.1 | hypothetical protein | - |
| WJ050_RS12025 (WJ050_12020) | - | 2400693..2402051 (+) | 1359 | WP_003722572.1 | recombinase family protein | - |
| WJ050_RS12030 (WJ050_12025) | - | 2402042..2402518 (+) | 477 | WP_020975176.1 | competence protein ComK | - |
| WJ050_RS12035 (WJ050_12030) | - | 2402573..2402920 (-) | 348 | WP_003739618.1 | helix-turn-helix domain-containing protein | - |
Sequence
Protein
Download Length: 160 a.a. Molecular weight: 17837.65 Da Isoelectric Point: 4.9909
>NTDB_id=959582 WJ050_RS11890 WP_003722552.1 2388414..2388896(-) (ssbA) [Listeria monocytogenes EGD-e]
MMNRVVLVGRLTKDPDLRYTPAGVAVATFTLAVNRTFTNQNGEREADFINCVVWRKPAENVANFLKKGSMAGVDGRVQTR
NYEDNDGKRVFVTEVVAESVQFLEPKNNNVEGATSNNYQNKANYSNNNQTSSYRADTSQKSDSFASEGKPIDINEDDLPF
MMNRVVLVGRLTKDPDLRYTPAGVAVATFTLAVNRTFTNQNGEREADFINCVVWRKPAENVANFLKKGSMAGVDGRVQTR
NYEDNDGKRVFVTEVVAESVQFLEPKNNNVEGATSNNYQNKANYSNNNQTSSYRADTSQKSDSFASEGKPIDINEDDLPF
Nucleotide
Download Length: 483 bp
>NTDB_id=959582 WJ050_RS11890 WP_003722552.1 2388414..2388896(-) (ssbA) [Listeria monocytogenes EGD-e]
ATGATGAATCGTGTAGTACTTGTAGGACGATTAACAAAAGATCCGGATTTACGTTACACTCCAGCAGGCGTAGCAGTCGC
GACTTTTACATTAGCAGTAAATCGTACATTCACTAATCAAAACGGAGAACGAGAAGCAGATTTCATTAATTGTGTTGTTT
GGCGCAAACCAGCAGAAAACGTTGCTAATTTCTTGAAGAAAGGAAGCATGGCGGGCGTTGATGGACGTGTTCAAACTCGT
AATTATGAGGATAACGACGGTAAACGTGTTTTCGTTACTGAGGTAGTTGCTGAATCAGTTCAATTCTTAGAACCTAAAAA
TAACAACGTAGAAGGTGCTACATCGAATAATTACCAAAACAAGGCTAATTATTCAAATAACAATCAAACAAGCTCATATC
GAGCGGATACGAGTCAGAAGAGCGATTCATTTGCAAGTGAAGGTAAGCCGATTGATATTAATGAAGATGATTTGCCATTT
TGA
ATGATGAATCGTGTAGTACTTGTAGGACGATTAACAAAAGATCCGGATTTACGTTACACTCCAGCAGGCGTAGCAGTCGC
GACTTTTACATTAGCAGTAAATCGTACATTCACTAATCAAAACGGAGAACGAGAAGCAGATTTCATTAATTGTGTTGTTT
GGCGCAAACCAGCAGAAAACGTTGCTAATTTCTTGAAGAAAGGAAGCATGGCGGGCGTTGATGGACGTGTTCAAACTCGT
AATTATGAGGATAACGACGGTAAACGTGTTTTCGTTACTGAGGTAGTTGCTGAATCAGTTCAATTCTTAGAACCTAAAAA
TAACAACGTAGAAGGTGCTACATCGAATAATTACCAAAACAAGGCTAATTATTCAAATAACAATCAAACAAGCTCATATC
GAGCGGATACGAGTCAGAAGAGCGATTCATTTGCAAGTGAAGGTAAGCCGATTGATATTAATGAAGATGATTTGCCATTT
TGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
65.116 |
100 |
0.7 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.294 |
100 |
0.587 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
63.208 |
66.25 |
0.419 |