Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   WDR05_RS16300 Genome accession   NZ_CP149444
Coordinates   3119781..3119921 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain HC-9     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3114781..3124921
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WDR05_RS16275 (WDR05_16255) yuxO 3115058..3115438 (-) 381 WP_015714624.1 hotdog fold thioesterase -
  WDR05_RS16280 (WDR05_16260) comA 3115457..3116101 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  WDR05_RS16285 (WDR05_16265) comP 3116182..3118494 (-) 2313 WP_069703660.1 histidine kinase Regulator
  WDR05_RS16290 (WDR05_16270) comX 3118510..3118731 (-) 222 WP_014480704.1 competence pheromone ComX -
  WDR05_RS16295 (WDR05_16275) - 3118733..3119596 (-) 864 WP_043858576.1 polyprenyl synthetase family protein -
  WDR05_RS16300 (WDR05_16280) degQ 3119781..3119921 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  WDR05_RS16305 (WDR05_16285) - 3120143..3120205 (+) 63 Protein_3145 hypothetical protein -
  WDR05_RS16310 (WDR05_16290) - 3120383..3120751 (+) 369 WP_017695529.1 hypothetical protein -
  WDR05_RS16315 (WDR05_16295) pdeH 3120727..3121956 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  WDR05_RS16320 (WDR05_16300) pncB 3122093..3123565 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  WDR05_RS16325 (WDR05_16305) pncA 3123581..3124132 (-) 552 WP_038828671.1 cysteine hydrolase family protein -
  WDR05_RS16330 (WDR05_16310) yueI 3124229..3124627 (-) 399 WP_032726794.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=959147 WDR05_RS16300 WP_003220708.1 3119781..3119921(-) (degQ) [Bacillus subtilis strain HC-9]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=959147 WDR05_RS16300 WP_003220708.1 3119781..3119921(-) (degQ) [Bacillus subtilis strain HC-9]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1