Detailed information
Bioinformatically predicted
Overview
| Name | cipB | Type | Regulator |
| Locus tag | QMM33_RS02510 | Genome accession | NZ_AP025940 |
| Coordinates | 487740..487889 (+) | Length | 49 a.a. |
| NCBI ID | WP_001809846.1 | Uniprot ID | Q00MV6 |
| Organism | Streptococcus pneumoniae strain PZ900700204 | ||
| Function | indirect induction of ComX; activation of comRS system (predicted from homology) Competence regulation |
||
Genomic Context
Location: 482740..492889
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QMM33_RS02485 (PC0204_04750) | blpC | 483000..483155 (-) | 156 | WP_044791640.1 | quorum-sensing system pheromone BlpC | - |
| QMM33_RS02490 | - | 483212..484573 (-) | 1362 | Protein_492 | bacteriocin secretion accessory protein | - |
| QMM33_RS02495 (PC0204_04780) | comA/nlmT | 484584..486260 (-) | 1677 | WP_318155894.1 | peptide cleavage/export ABC transporter | Regulator |
| QMM33_RS10570 (PC0204_04790) | comA/nlmT | 486154..486741 (-) | 588 | WP_000205166.1 | cysteine peptidase family C39 domain-containing protein | Regulator |
| QMM33_RS02500 (PC0204_04800) | blpM | 487023..487277 (+) | 255 | WP_001093256.1 | two-peptide bacteriocin subunit BlpM | - |
| QMM33_RS02505 (PC0204_04810) | blpN | 487293..487496 (+) | 204 | WP_001099490.1 | two-peptide bacteriocin subunit BlpN | - |
| QMM33_RS02510 (PC0204_04820) | cipB | 487740..487889 (+) | 150 | WP_001809846.1 | bacteriocin-like peptide BlpO | Regulator |
| QMM33_RS02515 | - | 487993..488112 (+) | 120 | WP_000346296.1 | PncF family bacteriocin immunity protein | - |
| QMM33_RS02520 (PC0204_04830) | - | 488410..488574 (+) | 165 | WP_000727117.1 | hypothetical protein | - |
| QMM33_RS02525 (PC0204_04840) | - | 488636..488974 (+) | 339 | WP_088804618.1 | immunity protein | - |
| QMM33_RS02530 (PC0204_04860) | - | 489603..489986 (+) | 384 | WP_000877381.1 | hypothetical protein | - |
| QMM33_RS02535 (PC0204_04870) | - | 490038..490727 (+) | 690 | WP_000760520.1 | CPBP family intramembrane glutamic endopeptidase | - |
| QMM33_RS02540 (PC0204_04880) | blpZ | 490769..491017 (+) | 249 | WP_000276501.1 | immunity protein BlpZ | - |
| QMM33_RS02545 | - | 491047..491658 (+) | 612 | WP_000394036.1 | type II CAAX endopeptidase family protein | - |
| QMM33_RS02550 (PC0204_04890) | - | 491819..492613 (+) | 795 | WP_000363002.1 | phosphotransferase family protein | - |
Sequence
Protein
Download Length: 49 a.a. Molecular weight: 5149.92 Da Isoelectric Point: 4.0439
>NTDB_id=95497 QMM33_RS02510 WP_001809846.1 487740..487889(+) (cipB) [Streptococcus pneumoniae strain PZ900700204]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV
Nucleotide
Download Length: 150 bp
>NTDB_id=95497 QMM33_RS02510 WP_001809846.1 487740..487889(+) (cipB) [Streptococcus pneumoniae strain PZ900700204]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| cipB | Streptococcus mutans UA159 |
53.061 |
100 |
0.531 |