Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   WHO18_RS17250 Genome accession   NZ_CP148128
Coordinates   3255442..3255609 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis isolate FELIX_MS620     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3250442..3260609
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WHO18_RS17220 mrpE 3250837..3251313 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  WHO18_RS17225 mrpF 3251313..3251597 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  WHO18_RS17230 mnhG 3251581..3251955 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  WHO18_RS17235 yuxO 3251994..3252374 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  WHO18_RS17240 comA 3252393..3253037 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  WHO18_RS17245 comP 3253118..3255427 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  WHO18_RS17250 comX 3255442..3255609 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  WHO18_RS17255 comQ 3255597..3256496 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  WHO18_RS17260 degQ 3256681..3256821 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  WHO18_RS17265 - 3257043..3257168 (+) 126 WP_003228793.1 hypothetical protein -
  WHO18_RS17270 - 3257282..3257650 (+) 369 WP_003243784.1 hypothetical protein -
  WHO18_RS17275 pdeH 3257626..3258855 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  WHO18_RS17280 pncB 3258992..3260464 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=951470 WHO18_RS17250 WP_003242801.1 3255442..3255609(-) (comX) [Bacillus subtilis isolate FELIX_MS620]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=951470 WHO18_RS17250 WP_003242801.1 3255442..3255609(-) (comX) [Bacillus subtilis isolate FELIX_MS620]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1