Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   WHO32_RS13405 Genome accession   NZ_CP148112
Coordinates   2556099..2556482 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   -
Organism   Bacillus subtilis isolate FELIX_MS504     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2551099..2561482
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  WHO32_RS13365 sinI 2552033..2552206 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  WHO32_RS13370 sinR 2552240..2552575 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  WHO32_RS13375 tasA 2552668..2553453 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  WHO32_RS13380 sipW 2553517..2554089 (-) 573 WP_003246088.1 signal peptidase I -
  WHO32_RS13385 tapA 2554073..2554834 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  WHO32_RS13390 yqzG 2555106..2555432 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  WHO32_RS13395 spoIIT 2555474..2555653 (-) 180 WP_003230176.1 YqzE family protein -
  WHO32_RS13400 comGG 2555724..2556098 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  WHO32_RS13405 comGF 2556099..2556482 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  WHO32_RS13410 comGE 2556508..2556855 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  WHO32_RS13415 comGD 2556839..2557270 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  WHO32_RS13420 comGC 2557260..2557556 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  WHO32_RS13425 comGB 2557570..2558607 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  WHO32_RS13430 comGA 2558594..2559664 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  WHO32_RS13435 corA 2560076..2561029 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=950843 WHO32_RS13405 WP_003230168.1 2556099..2556482(-) (comGF) [Bacillus subtilis isolate FELIX_MS504]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=950843 WHO32_RS13405 WP_003230168.1 2556099..2556482(-) (comGF) [Bacillus subtilis isolate FELIX_MS504]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1